| PDBID: | 9m07 | | Status: | HPUB -- hold until publication | | Title: | Histidine kinase QseE sensor domain of Salmonella Typhimurium SL1344 | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m08 | | Status: | HPUB -- hold until publication | | Title: | Structure of outer membrane lipoprotein QseG and histidine kinase QseE complex | | Authors: | Gao, X., Li, G.B., Gong, P.Q. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m09 | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with substrate | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0b | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of alpha-agarase AGA from Catenovulum maritimum | | Authors: | Zhang, X.M., Li, W.H., Han, X.D. | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0a | | Status: | HPUB -- hold until publication | | Title: | Structure of TqaM from Penicillium aethiopicum in complex with D-(+)-3-phenyllactic acid | | Authors: | Wang, H., Mori, T., Abe, I. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0c | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9m0j | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human endonuclease G mutant C113A/H141A | | Authors: | Yang, W.Z., Yuan, H.S. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human endonuclease G mutant C113A/H141A bound with trans-Resveratrol | | Authors: | Yang, W.Z., Yuan, H.S. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9m0f | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2025-02-24 | | Release date: | 2026-02-24 |
|
| PDBID: | 9nhh | | Status: | HPUB -- hold until publication | | Title: | AMC016 v4.2 in complex with pAb Base-A isolated from animal RQk18 at week 43 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhi | | Status: | HPUB -- hold until publication | | Title: | AMC016 v4.2 in complex with Base-C pAb isolated from animal RQk18 at week 43 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 | | Sequence: | >Entity 1
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
>Entity 2
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)W(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)C(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)F(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
>Entity 3
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARAEEELWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHCCVPTDPSPQEVVLENVTENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTDLGNATDAINRNTTDAPNSTLRTMEEKGEIKNCSFNITTSVRDKMQKEYATFYKLDIVPIDNDNNSYRLINCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEIVIRSENFTDNGKTIIVQLNESVEINCTRPNNNTRKSIHIGPGRAFYTTGQIIGNIRQAHCNISRAKWNNTLHKIVKKLREQFRNKTIVFKQSSGGDPEIVMHSFNCGGEFFYCNSTQLFNSTWYGNESSDNPGVEGNITLPCRIKQIINLWQEVGKAMYAPPIGGQIRCSSNITGLLLTRDGGNNNITTEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKCKRRVVQRRRRRR
>Entity 4
AVGIGAVFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQSNLLRAPECQQHLLKDTHWGIKQLQARVLAVEHYLKDQQLLGIWGCSGKLICTTAVPWNATWSNKTLDNIWNNMTWMEWEKEISNYTNLIYNLIEESQNQQEKNETENLTLC
|
|
| PDBID: | 9nhj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | AMC016 v4.2 in complex with FP-A pAb from animal RQk18 at week 43 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhk | | Status: | HPUB -- hold until publication | | Title: | BG505-CH505 Env glycoprotein in complex with NHP pAb Base-4 isolated from animal RUu18 at week 14 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhl | | Status: | HPUB -- hold until publication | | Title: | BG505-CH505 Env glycoprotein in complex with NHP pAb FP-1 isolated from animal RUu18 at week 14 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhm | | Status: | HPUB -- hold until publication | | Title: | BG505-CH505 Env glycoprotein in complex with NHP pAb V1V2V3-1 isolated from animal RUu18 at week 14 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhn | | Status: | HPUB -- hold until publication | | Title: | BG505-CH505 Env glycoprotein in complex with NHP pAb V1V2V3-2 isolated from animal RUu18 at week 14 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nho | | Status: | HPUB -- hold until publication | | Title: | BG505-CH505 Env glycoprotein in complex with NHP pAb V1V2V3-5 isolated from animal RUu18 at week 14 | | Authors: | Pratap, P.P., Ozorowski, G., Ward, A.B. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of SIWI-piRNA-target(25-nt)-GTSF1 complex | | Authors: | Sarkar, S., Gebert, L.F.R., MacRae, I.J. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhc | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SIWI-piRNA-target(49-nt)-GTSF1-Maelstrom complex | | Authors: | Sarkar, S., Gebert, L.F.R., MacRae, I.J. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh5 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable H2A* SUBSTRATE PRE-MRNA (core region) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nh6 | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF HUMAN U7 SNRNP WITH METHYLATED noncleavable mH2A* SUBSTRATE PRE-MRNA (COMPOSITE MAP) | | Authors: | Desotell, A., Tong, L. | | Deposition date: | 2025-02-24 |
|
| PDBID: | 9nhp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-24 |
|
