| PDBID: | 9efu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efw | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efm | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of COP9 signalosome deneddylation complex with neddylated cullin-1 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg7 | | Status: | HPUB -- hold until publication | | Title: | X-ray diffraction structure of papain co-crystallized with E64-C | | Authors: | Vlahakis, N.W., Rodriguez, J.A., Tang, Y. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efv | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CSN-N8CUL1 in complex with CSN5i-3 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eft | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efd | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure in space group C2221 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eff | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of a nucleoid-associated protein (UBP) bound to DNA from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efn | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of Saccharomyces cerevisiae cross-linked Sfh1 (K197C, F233C) mutant in complex with phosphatidylethanolamine | | Authors: | Green, S.M., Laganowsky, A., Krieger, I., Singh, P.K., Igumenova, T.I., Bankaitis, V.A., Sacchettini, J. | | Deposition date: | 2024-11-20 | | Release date: | 2025-11-20 |
|
| PDBID: | 9efb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efe | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure in space group P21 of a nucleoid-associated protein (UBP) from Sulfolobus islandicus. | | Authors: | Dhanaraju, R., Gonzalez-Gutierrez, G., Bell, S.D. | | Deposition date: | 2024-11-20 | | Sequence: | >Entity 1
HMIVMRVKVNEKQFDMIIDKLKLMVYEYNTKIKEYGVYLKPYHIVYKNSKRYIYIGKYWYKLEKIGGKLKWIYLGKTKPIQNMPNPPQIPESTIIKEDNEYIVDEKILYDLE
|
|
| PDBID: | 9efk | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efq | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of COP9 signalosome deneddylation complex with neddylated cullin-2 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9efa | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-11-20 |
|
| PDBID: | 9eg1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | COP9 signalosome deneddylation complex with cullin-5 | | Authors: | Shi, H., Zheng, N. | | Deposition date: | 2024-11-20 |
|
