| PDBID: | 9fb0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh0 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with metal Iron | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 | | Sequence: | >Entity 1
MGSSWSHPQFEKMSTVDTAPQSHYQETKVSEIPIVILKSSATDDVAAHEAIEALKVAGVCIVRNLLDRSTVDKVRQELQPYDKQADSFEGFPKNYCQVAGLLSKSPTYAHSIVGNKLFTAVRNYFLTSTYECWAEKGTWMSVKSPPQLDSTLALYVNPGSGDQGLHRDDATQQNWNSGASEYSLGRDSGCAMMVALTECAREDGTTRFIPGSHLWDYQYDHPSNDDPRIRYAEMRPGDAYLMLSSVIHAGSVNYSTDRRRVLAAVFAARSHLRQVENQYLTYDIETVRTFPTWLQRFMGYSLSKLFQGWVDKKDPLLVVDPNAQPEGEDDGGMKPNEGEHVVEAQI
|
|
| PDBID: | 8zh1 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh9 | | Status: | HPUB -- hold until publication | | Title: | The structure of ELK1-DNA complex | | Authors: | Liu, G., Sun, L.T. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of inward state Anhydromuropeptide permease (AmpG) | | Authors: | Cho, H.S., Kim, U., Chang, N., Kim, H., Yoo, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh2 | | Status: | HPUB -- hold until publication | | Title: | Fe(II)/(alpha)ketoglutarate-dependent dioxygenase cnsJ with a-ketoglutarate and Communesin K | | Authors: | Wang, J., Wang, X.Y., Yan, W.P. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zhc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zh7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of N-terminal domain of N-methyl-D-aspartate receptor subunit NR1 in complex with patient-derived antibody | | Authors: | Nomura, N., Kumazaki, K., Amano, Y. | | Deposition date: | 2024-05-10 |
|
| PDBID: | 8zgi | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-05-09 | | Release date: | 2025-05-09 |
|
| PDBID: | 8zgv | | Status: | HPUB -- hold until publication | | Title: | Drimenyl diphosphate synthase SsDMS_F248A&D303E from Streptomyces showdoensis in complex with farnesyl diphosphate (FPP) and Mg2+ | | Authors: | Pan, X.M., Dong, S.M., Dong, L.B. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqb | | Status: | HPUB -- hold until publication | | Title: | Human Topoisomerase 2 Alpha ATPase domain bound to topobexin and non-hydrolyzable ATP analog AMPPNP | | Authors: | Cong, A.T.Q., Austin, C.A., Kubes, J., Karabanovich, G., Melnikova, I., Lencova, O., Kollarova, P., Piskackova, H.B., Kerestes, V., Applova, L., Arrouye, L., Alvey, J.A., Paluncic, J., Witter, T.L., Jirkovska, A., Kunes, J., Sterbova, P., Sterba, M., Simunek, T., Roh, J., Schellenberg, M.J. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bq7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bq9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bq8 | | Status: | HPUB -- hold until publication | | Title: | Human Topoisomerase 2 Beta ATPase domain bound to non-hydrolyzable ATP analog AMPPNP | | Authors: | Cong, A.T.Q., Austin, C.A., Kubes, J., Karabanovich, G., Melnikova, I., Lencova, O., Kollarova, P., Piskackova, H.B., Kerestes, V., Applova, L., Arrouye, L., Alvey, J.A., Paluncic, J., Witter, T.L., Jirkovska, A., Kunes, J., Sterbova, P., Sterba, M., Simunek, T., Roh, J., Schellenberg, M.J. | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
| PDBID: | 9bqc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-09 |
|
