| PDBID: | 8ziz | | Status: | HPUB -- hold until publication | | Title: | enteropeptidase with N619A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj4 | | Status: | HPUB -- hold until publication | | Title: | trypsinogen-EP-N619A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zj9 | | Status: | HPUB -- hold until publication | | Title: | Acinetobacter baumannii ModA with tungstate DTT | | Authors: | Wen, Y., Jiao, M. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zja | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8zjg | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin | | Authors: | Liu, A.J., Liu, Y.Z., Ye, R.D. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 9bs9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsb | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bs7 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor Vinylpyridine | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bs6 | | Status: | HPUB -- hold until publication | | Title: | CryoEM structure of ThermoCas9 in post-cleavage state with a DNA containing NNNNCGA PAM | | Authors: | Zhao, Y., Shu, Y. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 | | Sequence: | >Entity 1
MNNSKIISKVLLSLSLFTVGASAFVIQDELMQKKHAKAEVSAEEIKKHEEKWNKYYGVNAFNLPKELFSKVDEKDRQKYPYNTIGNVFVKGQTSATGVLIGKNTVLTNRHIAKFANGDPSKVSFRPSINTDDNGNTETPYGEYEVKEILQEPFGAGVDLALIRLKPDQNGVSLGDKISPAKIGTSNDLKDGDKLELIGYPFAHKVNQMHRSEIELTTLSRGLRYYGFTVPGNSGSGIFNSNGELVGIHSSKVSHLDREHQINYGVGIGNYVKRIINEKNE
|
|
| PDBID: | 9bs8 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-107 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsa | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-B-112 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bse | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor YR-B-165 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsf | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-A-171 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsg | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor VB-C-20 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
| PDBID: | 9bsm | | Status: | HPUB -- hold until publication | | Title: | Staphylococcus aureus exfoliative toxin A D164E variant | | Authors: | Holyoak, T., Tran, N. | | Deposition date: | 2024-05-13 |
|
| PDBID: | 9bsi | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the SARS-CoV-2 main protease in complex with inhibitor SR-B-7 | | Authors: | Blankenship, L.R., Liu, W.R. | | Deposition date: | 2024-05-13 | | Release date: | 2025-05-13 |
|
