| PDBID: | 8wv0 | | Status: | HPUB -- hold until publication | | Title: | Outer membrane porin of Burkholderia pseudomallei (BpsOmp38) | | Authors: | Bunkum, P., Aunkham, A., Bert van den, B., Robinson, R.C., Suginta, W. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8wv1 | | Status: | HPUB -- hold until publication | | Title: | Ambient Temperature Structure of 50S Ribosomal Subunit from Thermus Thermophilus | | Authors: | DeMirci, H., Tosun, B. | | Deposition date: | 2023-10-22 |
|
| PDBID: | 8qx3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 |
|
| PDBID: | 8wur | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-Cov-2 main protease D48N mutant in complex with shikonin | | Authors: | Zhao, Z.Y., Li, W.W., Zhang, J., Li, J. | | Deposition date: | 2023-10-21 | | Release date: | 2024-10-21 |
|
| PDBID: | 8up5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-21 | | Release date: | 2025-04-20 |
|
| PDBID: | 8qx1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uom | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3dimeK4 histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8uon | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 | | Release date: | 2025-04-19 |
|
| PDBID: | 8up4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-20 |
|
| PDBID: | 8wu9 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human canonical nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8wuj | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana H2A.W nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8wuh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of A. thaliana canonical H2A.13 nucleosome | | Authors: | Liu, X., Gong, Q.Y. | | Deposition date: | 2023-10-20 | | Release date: | 2025-04-20 |
|
| PDBID: | 8qw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8qw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8qwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-23 |
|
| PDBID: | 8qwj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of GFP variant | | Authors: | Lenz, M., Fiedler, M., Bellini, D., Chin, J.W. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8uni | | Status: | HPUB -- hold until publication | | Title: | LSD1-CoREST with N-formyl-FAD in complex with H3K4M histone tail | | Authors: | Caroli, J., Mattevi, A. | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8uo5 | | Status: | HPUB -- hold until publication | | Title: | Protein Phosphatase 2A B55 subunit in complex with IER5 | | Authors: | Jones, D.T.D., Blacklow, S.C., Cao, R., Rawson, S.D. | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-18 |
|
| PDBID: | 8wts | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 3CLpro bound to covalent inhibitor | | Authors: | Peng, J., Sun, D., Ding, X. | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8unk | | Status: | HPUB -- hold until publication | | Title: | Structure of the KEOPS complex (Cgi121/Bud32/Kae1/Pcc1) | | Authors: | Ona Chuquimarca, S.M., Beenstock, J., Daou, S., Keszei, A.F.A., Yin, Z., Sicheri, F. | | Deposition date: | 2023-10-19 | | Release date: | 2025-04-18 |
|
| PDBID: | 8uoj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-19 |
|
| PDBID: | 8qvn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Cx26 from Gallus Gallus in bicarbonate buffer | | Authors: | Brotherton, D.H., Cameron, A.D. | | Deposition date: | 2023-10-18 | | Sequence: | >Entity 1
MDWGTLQAVLGGVNKHSTSIGKIWLTVLFIFRIMILVVAAERVWGDEQQDFVCNTLQPGCRNVCYDHFFPISHIRLWALQLIFVSTPALLVAMHVAYTRHERKRRFRSGDKINIEELKNEKIHIRGPLWWTYTCSIFFRIVFEAVFMYVFYYMYDGYQMPRLVKCDAWPCPNVVDCFVSRPTEKTTFTIFMLAVSGICMMLNLAELCYLVIKVCLKDSGKTTVLK
|
|
| PDBID: | 8qvq | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8qvr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-18 | | Release date: | 2025-04-18 |
|
| PDBID: | 8qvt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-18 |
|
