| PDBID: | 9bdg | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85647 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd5 | | Status: | HPUB -- hold until publication | | Title: | Laccase from Bacillus licheniformis | | Authors: | Habib, M.H., Smith, T.J. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MKLEKFVDKLPIPKVLKPHSKSKEMTYYEVTMKEFQQQLHRDLPPTRLFGYNGVYPGPTFEVQKHEKVAVKWLNKLPDHHFLPVDHTIHDDGHHEHEVKTVVHLHGGRTPPDSDGYPEAWYTKDFQVKGPFFEREVYEYPNEQDATALWYHDHAMAITRLNVYAGLVGLYFIRDREERSLNLPKGEYEIPLLIQDKSFHEDGSLFYPRQPDNPSPDLPDPSIVPAFCGDTILVNGKVWPYDELEPRKYRFRILNASNTRIFELYFDHDITFHQIGTDGGLLQHPVKVNELVIAPAERCDIIVDFSRAEGKTVTLKNRIGCSGQDADPDTDANIMQFRISKPLKQKDTSSLPRILRKRPFYRRHKINTLRNLSLGASLDQYGRPVLLLNNTKWHEPVTETPALGSTEIWSIINAGRAIHPIHLHLVQFLILDHRPFDIERYQENGELVFTGPAAPPAQNEKGLKDTVKVPPGSVTRIIATFAPYSGRYVWHCHILEHEDYDMMRPLEVTDIRHQEFEAWARTKTHLRRGSE
|
|
| PDBID: | 9bda | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bde | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdf | | Status: | HPUB -- hold until publication | | Title: | Influenza A virus Hemagglutinin H3/Darwin/6/2021 in complex with Fab ADI-85666 | | Authors: | Ferreira Ramos, A.S., Bajic, G. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS CoV-2 full-length spike protein, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bdb | | Status: | HPUB -- hold until publication | | Title: | Bacillus anthracis BxpB homotrimer in complex with BclA NTD peptide | | Authors: | Schormann, N., Green, T., Turnbough, C.L. | | Deposition date: | 2024-04-11 | | Sequence: | >Entity 1
MFSSDCEFTKIDCEAKPASTLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIRILRAGIYQISYTLTISLDNSPVAPEAGRFFLSLGTPANIIPGSGTAVRSNVIGTGEVDVSSGVILINLNPGDLIRIVPVELIGTVDIRAAALTVAQIS
>Entity 2
AFDPNLVGPTLPPIPPFTL
|
|
| PDBID: | 9bd8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bd7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ezc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ez9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ezd | | Status: | HPUB -- hold until publication | | Title: | BsmI (Bottom Nicking mutant) crystallized with Mg2+ and cognate dsDNA (Post-reactive complex) | | Authors: | Sieskind, R., Missoury, S., Madru, C., Commenge, I., Niogret, G., Rondelez, Y., Haouz, A., Legrand, P., Sauguet, L., Delarue, M. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ezb | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant P67S | | Authors: | Dhamotharan, K., Schlundt, A., Guenther, S. | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9eze | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9ez6 | | Status: | HPUB -- hold until publication | | Title: | Complex of a mutant of the SARS-CoV-2 main protease Mpro with the nsp14/15 substrate peptide. | | Authors: | Battistutta, R., Fornasier, E., Giachin, G. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z12 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WT DiatB | | Authors: | Peng, M., Wu, Q.L. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z0p | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human ELAC2 | | Authors: | Liu, Z.M., Xue, C.Y. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z0q | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of dimer HtmB2-CT | | Authors: | Sun, Y.H., Zhang, Z.Y., Mei, Q. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z0m | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z16 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DiatB mutant N57A | | Authors: | Peng, M., Wu, Q.L. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z17 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DiatB mutant R360A | | Authors: | Peng, M., Wu, Q.L. | | Deposition date: | 2024-04-10 |
|
