PDBID: | 8kco | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcr | Status: | HPUB -- hold until publication | Title: | Crystal Structure of E447A Acyl-CoA Dehydrogenase FadE15 mutant from Mycobacteria tuberculosis in complex with C18CoA | Authors: | Liu, X., Chen, R., Ma, M. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcp | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcs | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with BMS906024 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kct | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with Nirogacestat | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kcu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human gamma-secretase in complex with MK-0752 | Authors: | Guo, X., Li, H., Kai, U., Yan, C., Lei, J., Zhou, R., Shi, Y. | Deposition date: | 2023-08-08 |
|
PDBID: | 8kd1 | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2025-02-08 |
|
PDBID: | 8q55 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-08 |
|
PDBID: | 8q5c | Status: | HPUB -- hold until publication | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) and compound 12 (1075475) | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqq | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqr | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqn | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-08-08 | Release date: | 2024-08-08 |
|
PDBID: | 8tqt | Status: | HPUB -- hold until publication | Title: | MPI52 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqu | Status: | HPUB -- hold until publication | Title: | MPI51 bound to Mpro of SARS-CoV-2 | Authors: | Blankenship, L.R., Liu, W.R. | Deposition date: | 2023-08-08 |
|
PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 8tqw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-08-08 |
|
PDBID: | 8q5s | Status: | HPUB -- hold until publication | Title: | Anaerobic crystal structure of apo-HIF prolyl hydroxylase 2 (PHD2 181-407)in complex with acetate (ACT) and HIF2alpha-CODD peptide | Authors: | Fiorini, G., Figg Jr, W.D., Schofield, C.J. | Deposition date: | 2023-08-09 |
|
PDBID: | 8kd8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kdm | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kdl | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kdk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kd9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kda | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kdd | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|
PDBID: | 8kdf | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-09 |
|