| PDBID: | 8k2v | | Status: | HPUB -- hold until publication | | Title: | 3-Methylcrotonyl-CoA Carboxylase in MCCD state with Acetyl CoA | | Authors: | Liu, D.S., Su, J.Y., Tian, X.Y. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt0 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU75 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt1 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU76 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt3 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU77 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgu | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of BG505 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Parsons, R.J., Pothula, K., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of 1059 SOSIP trimer purified via Galanthus nivalis lectin chromatography | | Authors: | Pothula, K., Parsons, R.J., Acharya, P. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgx | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgs | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of the post-reactive state of UDP-sugar pyrophosphorylase from Leishmania major in complex with product UDP-Glucose and by-product analog VO4 (orthovanadate) | | Authors: | Prakash, O., Fuehring, J.I., Baruch, P., Routier, F.H., Fedorov, R. | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8tgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8tgq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-15 |
|
| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 8ptt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k33 | | Status: | HPUB -- hold until publication | | Title: | SOD1 and Nanobody1 complex | | Authors: | Cheng, S. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k32 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of SLKARI with NADH at 2.12-angstrom resolution | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 8k2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 8k3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8ptf | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8ptv | | Status: | HPUB -- hold until publication | | Title: | IPNS variant N252Q in complex with Fe and ACV under anaerobic conditions | | Authors: | Rabe, P., Schofield, C.J. | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8k3h | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PseP with NAD at 2.86 angstrom resolution | | Authors: | Mori, T., Awakawa, T., Adachi, N., Abe, I. | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8k3g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of non-specific phospholipase C RePLC (Rasamsonia emersonii) | | Authors: | Feng, C.H., Wang, Y.H. | | Deposition date: | 2023-07-15 |
|
| PDBID: | 8k3i | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of PseP apo | | Authors: | Mori, T., Awakawa, T., Adachi, N., Abe, I. | | Deposition date: | 2023-07-15 |
|
