| PDBID: | 9jfc | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa SuhB complexed with Gallic acid in monoclinic space group | | Authors: | Yadav, V.K., Shukla, M., Maji, S., Bhattacharyya, S. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jff | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfm | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfk | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfl | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of sal87-DndI | | Authors: | Dan, W. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf5 | | Status: | HPUB -- hold until publication | | Title: | Arginine decarboxylase in Aspergillus oryzae complexed with arginine | | Authors: | Mikami, B., Yaukawa, K., Fujiwara, S., Takita, T., Mizutani, K., Odagaki, Y., Murakami, Y. | | Deposition date: | 2024-09-04 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMQSVRIIPTYIERAPGAPATGSSLHSHGHWMPENVELRRAWLSSLLDKTKAEIPRKLRDNVENPVETFRKLIENDSTLYMLAHSMFDEVPEKAPYDRDPTTLKKQVRNYKTMLYLFNTLLTEVPEYFLRDNPNVPSGLIGFPFNIIVDWPMGTPSGRQFFLDTRVNKCLKDILNKWNEFLKDPTAQGNGNKGGNQALIDAGWSSDAAVEQLVNKANESTTDKKKTFSEIFQHPANGTQENFFNYACWDNFFTRRFKDGVRPVADAAVVNACESFPLSFDTDVSRRNTFWLKGTPYSLHDMLGATQDERVASYVDGFVGGSVYQAFLSADSYHCWNAPVTGKVVYRSLIDGTYFAETAAAGFGGSNGPDPAGPDVSQRYITHIAARGVLIVDTNVTGGAKIGLVGFVPVGMSEVSTCDWFDNTEEGKTISKGDVIGAFHSGGS
>Entity 2
THCLIFQRDAVKKLQFIPKAQYPEIATTNLAVNSELAKLTS
|
|
| PDBID: | 9jf6 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf7 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jf9 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human insulin receptor bound with A62-dimer, Pseudo-arrowhead conformation | | Authors: | Kim, J., Na, J., Yunn, N., Ryu, S., Cho, Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfa | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Single Ring, conformer 2) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Wild-type structure of catalytic domains from threonine deaminase in complex with PLP | | Authors: | Khodi, S. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfd | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human insulin receptor bound with A62-dimer, Pseudo-gamma conformation | | Authors: | Kim, J., Na, H., Yunn, N., Ryu, S., Cho, Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfe | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Double ring, Confomer 1) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9jfg | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Escherichia coli Acetyl-coenzyme A Carboxylase Protomer Complex (Double ring, conformer 2) | | Authors: | Ng, J.C.H., Wen, X.K., Leung, S.K.P., Wang, J.Z.K., Lau, W.C.Y. | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dhv | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dho | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dht | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-04 |
|
| PDBID: | 9dgs | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Dynactin and dynein tail region of dynein-dynactin complex on microtubules | | Authors: | Rao, Q., Chai, P., Zhang, K. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9dgt | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of dynactin, dynein tail with one BICDR from dynein-dynactin-BICDR on microtubules | | Authors: | Rao, Q., Chai, P., Zhang, K. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9dgu | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of dynactin, dynein tail with two BICDR from dynein-dynactin-BICDR on microtubules | | Authors: | Rao, Q., Chai, P., Zhang, K. | | Deposition date: | 2024-09-03 |
|
| PDBID: | 9dgv | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | structure of dynactin, dynein tail with TRAK2 from dynein-dynactin-TRAK2 on microtubules | | Authors: | Rao, Q., Chai, P., Zhang, K. | | Deposition date: | 2024-09-03 |
|
