PDBID: | 8js7 | Status: | HPUB -- hold until publication | Title: | Dimeric PAS domains of oxygen sensor FixL in complex with imidazole-bound heme | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | Deposition date: | 2023-06-19 |
|
PDBID: | 8js5 | Status: | HPUB -- hold until publication | Title: | Dimeric PAS domains of oxygen sensor FixL with ferric unliganded heme | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | Deposition date: | 2023-06-19 |
|
PDBID: | 8js6 | Status: | HPUB -- hold until publication | Title: | Dimeric PAS domains of oxygen sensor FixL in complex with cyanide-bound ferric heme | Authors: | Kamaya, M., Koteishi, H., Sawai, H., Sugimoto, H., Shiro, Y. | Deposition date: | 2023-06-19 |
|
PDBID: | 8jsd | Status: | HPUB -- hold until publication | Title: | Alginate lyase mutant-D180G | Authors: | Zhang, X., Pan, L.X., Yang, D.F. | Deposition date: | 2023-06-19 |
|
PDBID: | 8jsa | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-19 |
|
PDBID: | 8phc | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8jse | Status: | HOLD -- hold until a certain date | Deposition date: | 2023-06-19 | Release date: | 2024-12-19 |
|
PDBID: | 8phm | Status: | HPUB -- hold until publication | Title: | Oxalate-bound cobalt(II) human carbonic anhydrase II | Authors: | Gigli, L., Malanho Silva, J., Cerofolini, L., Macedo, A.L., Geraldes, C.F.G.C., Suturina, E.A., Calderone, V., Fragai, M., Parigi, G., Ravera, E., Luchinat, C. | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 | Sequence: | >Entity 1 NWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEFDDSQDKAVLKGGPLDGTYRLIQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDFGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLLECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8jsf | Status: | HPUB -- hold until publication | Title: | Crystal structure of a cytidylate cyclase from multidrug-resistant bacterium Elizabethkingia anopheles | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of a DNA-protein complex | Authors: | Li, Z. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsz | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of a uridylate cyclase from Anabaena sp. | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsj | Status: | HPUB -- hold until publication | Title: | Crystal structure of an N-terminal cyclic nucleotide-binding domain of a PycTIR from Novosphingobium pentaromativorans | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsk | Status: | HPUB -- hold until publication | Title: | Crystal structure of an N-terminal cyclic nucleotide-binding domain of a PycTIR from Pseudovibrio sp. in complex with cUMP | Authors: | Wang, Y.-C., Yang, C.-S., Hou, M.-H., Chen, Y. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jst | Status: | HPUB -- hold until publication | Title: | GH11 family xylanase rMxylcd from the compost-soil metagenome | Authors: | Wu, S.N., Zhang, N.Y., Wan, Q. | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsq | Status: | AUCO -- author corrections pending review | Deposition date: | 2023-06-20 |
|
PDBID: | 8jss | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsu | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsy | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 |
|
PDBID: | 8jt0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 |
|
PDBID: | 8jsv | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 |
|
PDBID: | 8phz | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-20 |
|
PDBID: | 8pi0 | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 |
|
PDBID: | 8phn | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 |
|
PDBID: | 8phx | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-12-20 |
|
PDBID: | 8jsr | Status: | HPUB -- hold until publication | Deposition date: | 2023-06-20 | Release date: | 2024-09-25 |
|