| PDBID: | 9goh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gon | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 in complex with sulphostin | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 Ser730Ala in complex with sulphostin. | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9go8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9god | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of DPP9 in complex with N-phosphono-(S)-3-aminopiperidine-2-one-based inhibitor | | Authors: | Sewald, L., Tabak, W.W.A., Fehr, L., Zolg, S., Najdzion, M., Verhoef, C.J.A., Podlesainski, D., Geiss-Friedlander, R., Lammens, A., Kaschani, F., Hellerschmied, D., Huber, R., Kaiser, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goe | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gog | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with furan-2-carboxylic acid (3-ethoxy-2-hydroxybenzylidene)hydrazide | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gol | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of limonene epoxide hydrolase LEH 19 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gok | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | X-ray structure of lysozyme obtained upon reaction with the dioxidovanadium(V) complex with (E)-N''-(1-(2-hydroxy-5-methoxyphenyl)ethylidene)furan-2-carbohydrazide) | | Authors: | Paolillo, M., Ferraro, G., Merlino, A. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gom | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of limonene epoxide hydrolase LEH 31 | | Authors: | Levy, C.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9goo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of human carbonic anhydrase II in complex with PCI-27483 | | Authors: | Angeli, A., Ferraroni, M. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gop | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of CDK2-cyclin E1 bound by 2-[(2S)-1-(9-ethyl-6-{[1-methyl-3-(methylsulfonyl)-1H-pyrazol-5-yl]amino}-9H-purin-2-yl)-4,4-difluoro-2-pyrrolidinyl]-2-propanol. | | Authors: | Collie, G.W. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9gof | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-05 | | Sequence: | >Entity 1
MQSEQWRSLSNVVWGKDLPAFTYAFSKTPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRITLTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWLSHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLLGQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMDLTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLASNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
|
|
| PDBID: | 9jfs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg3 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfy | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg0 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Resembled the partial R-loop state with the PAM-distal spacer forming a base-pair interaction with the TS | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfo | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jfp | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Areconstituted LaTraC ternary complex with a full R-loop | | Authors: | Zhang, S., Liu, J. | | Deposition date: | 2024-09-05 |
|
| PDBID: | 9jg1 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of Adriforant-bound Histamine receptor 4 H4R at inactive state | | Authors: | Jin, S.S., Zhang, H., Jiang, Y. | | Deposition date: | 2024-09-05 | | Release date: | 2025-09-05 |
|
| PDBID: | 9jg2 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of lipoprotein-bound LolCDE in nanodiscs | | Authors: | Dong, H., Shen, C., Tang, X., Qiao, W. | | Deposition date: | 2024-09-05 |
|
