| PDBID: | 9nw4 | | Status: | HPUB -- hold until publication | | Title: | Structure of CISV1 antibody bound to PvCSP repeat peptide | | Authors: | Hurlburt, N.K., Pancera, M. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvn | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvo | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvp | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvr | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvs | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvv | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvw | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Cryo-EM structure of rhesus antibody CH35-Apex1.08 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw0 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH42-Apex2.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvt | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal domain of VARP (ANKRD27) | | Authors: | Chandra, M., Jackson, L.P. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw3 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Ciliary tip central pair | | Authors: | Legal, T.L., Bui, K.H. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw2 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of NP204 TCR in complex with NP366-H-2Db | | Authors: | Tan, K., Reinherz, E.L., Mallis, R.J. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nw6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9nvz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of rhesus antibody CH70-Apex1.01 in complex with HIV Env trimer Q23-APEX-GT2 | | Authors: | Roark, R.S., Shapiro, L.S., Kwong, P.D. | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-21 |
|
| PDBID: | 9qm7 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of S-nitrosylated triose phosphate isomerase from Chlamydomonas reinhardtii | | Authors: | Fanti, S., Fermani, S., Gabellini, G., Zaffagnini, M., Meloni, M., Peppi, G.M.E. | | Deposition date: | 2025-03-21 | | Sequence: | >Entity 1
ASSAKFFVGGNWK(SNC)NGSVANVAKLVDELNAGTIPRGVDVVVAPPFIYIDYVMQHLDRDKYQLSAQNAWIGGNGAFTGEVSAEQLTDFGVPWVILGHSERRSLFGESNEVVAKKTSHALAAGLGVIACIGETLEQRNSGSVFKVLDAQMDALVDEVKDWTKVVLAYEPVWAIGTGVVASPEQAQEVHAYLRQYCAKKLGAAVADKLRIIYGGSVSDTNCKDLSKQEDIDGFLVGGASLKGAAFVTICNAAGPKAKP
|
|
| PDBID: | 9qlh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-21 |
|
