| PDBID: | 8ptd | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG1 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8pts | | Status: | HPUB -- hold until publication | | Title: | human GUK1 in complex with compound AT8001 | | Authors: | Zimberger, C., Canard, B., Ferron, F. | | Deposition date: | 2023-07-14 | | Sequence: | >Entity 1
MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA
|
|
| PDBID: | 8ptt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k32 | | Status: | HPUB -- hold until publication | | Title: | The complex structure of SLKARI with NADH at 2.12-angstrom resolution | | Authors: | Chen, C.Y., Huang, C.H. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k30 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 8k2z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 | | Release date: | 2025-01-14 |
|
| PDBID: | 8k3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8k33 | | Status: | HPUB -- hold until publication | | Title: | SOD1 and Nanobody1 complex | | Authors: | Cheng, S. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8ptf | | Status: | HPUB -- hold until publication | | Title: | The surface-exposed lipo-protein of BtuG2 in complex with cyanocobalamin. | | Authors: | Whittaker, J., Felices Martinez, J.M., Guskov, A., Slotboom, D.J. | | Deposition date: | 2023-07-14 |
|
| PDBID: | 8ps4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-17 |
|
| PDBID: | 8ps5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-17 |
|
| PDBID: | 8ps6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-17 |
|
| PDBID: | 8ps7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8psw | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to RU67 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8psy | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU68 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pst | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU60 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt1 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU76 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A., Gogl, G. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt3 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU77 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt5 | | Status: | HPUB -- hold until publication | | Title: | ERK2 covelently bound to RU187 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt8 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to RU135 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8psr | | Status: | HPUB -- hold until publication | | Title: | ERK2 covalently bound to SynthRevD-12-opt artificial peptide | | Authors: | Sok, P., Poti, A., Gogl, G., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pt9 | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD838 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8pta | | Status: | HPUB -- hold until publication | | Title: | JNK1 covalently bound to BD837 cyclohexenone based inhibitor | | Authors: | Sok, P., Poti, A., Remenyi, A. | | Deposition date: | 2023-07-13 |
|
| PDBID: | 8k2u | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 8ps3 | | Status: | PROC -- to be processed | | Deposition date: | 2023-07-13 |
|
