PDBID: | 9ev8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-28 |
|
PDBID: | 9evb | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 9ev9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 9ev5 | Status: | HPUB -- hold until publication | Title: | Corynebacterium glutamicum CS176 pyruvate:quinone oxidoreductase (PQO) in complex with FAD and thiamine diphosphate-magnesium ion | Authors: | Da Silva Lameira, C., Muenssinger, S., Yang, L., Eikmanns, B.J., Bellinzoni, M. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yup | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvh | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvk | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvl | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvc | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell:icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 19) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvd | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 16) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvi | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 13) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yve | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: icosahedral assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T = 9) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvf | Status: | HPUB -- hold until publication | Title: | cryo-EM structure of carboxysomal midi-shell: assembly from CsoS4A/4B/1A/1B/1C/1D and CsoS2 C-terminal co-expression (T=9 Q=12) | Authors: | Wang, P., Li, J.X., Li, T.P., Li, K., Ng, P.C., Wang, S.M., Chriscoli, V., Basle, A., Marles-Wright, J., Zhang, Y.Z., Liu, L.N. | Deposition date: | 2024-03-28 | Sequence: | >Entity 1 GIALGMIETRGLVPAIEAADAMTKAAEVRLVGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHIIARVHSEVENILPKAPQ
>Entity 2 MKIMQVEKTLVSTNRIADMGHKPLLVVWEKPGAPRQVAVDAIGCIPGDWVLCVGSSAAREAAGSKSYPSDLTIIGIIDQWN
>Entity 3 RITGPGMLATGLITGTPEFRHAAREELVCAPRSDQMDRVSGEGKERCHITGDDWSVNKHITGTAGQWASGRNPSMRGNARVVETSAFANRNVPKPEKPGSKITGSSGNDTQGSLITYSGGARG
|
|
PDBID: | 8yvm | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvn | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yvj | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2592-2710 bound to H5.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv7 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Thialysine N-epsilon-acetyltransferase from Caenorhabditis elegans | Authors: | Wang, N., Ma, X. | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv5 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv8 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-03-28 |
|
PDBID: | 8yv9 | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yva | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvb | Status: | HOLD -- hold until a certain date | Deposition date: | 2024-03-28 | Release date: | 2025-03-28 |
|
PDBID: | 8yvo | Status: | HPUB -- hold until publication | Title: | Crystal structure of the C. difficile toxin A CROPs domain fragment 2639-2707 bound to C4.2 nanobody | Authors: | Sluchanko, N.N., Varfolomeeva, L.A., Shcheblyakov, D.V., Belyi, Y.F., Logunov, D.Y., Gintsburg, A.L., Popov, V.O., Boyko, K.M. | Deposition date: | 2024-03-28 |
|