| PDBID: | 9bl7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9fpw | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of carbonic anhydrase XIII with methyl 4-(2-phenylethylsulfanyl)-3-sulfamoyl-benzoate | | Authors: | Smirnov, A., Manakova, E.N., Grazulis, S., Paketuryte, V. | | Deposition date: | 2024-06-13 | | Sequence: | >Entity 1
MMSRLSWGYREHNGPIHWKEFFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPSSAKIISNSGHSFNVDFDDTENKSVLRGGPLTGSYRLRQVHLHWGSADDHGSEHIVDGVSYAAELHVVHWNSDKYPSFVEAAHEPDGLAVLGVFLQIGEPNSQLQKITDTLDSIKEKGKQTRFTNFDLLSLLPPSWDYWTYPGSLTVPPLLESVTWIVLKQPINISSQQLAKFRSLLCTAEGEAAAFLVSNHRPPQPLKGRKVRASFH
|
|
| PDBID: | 9bl1 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of heme-binding protein from Populus trichocarpa | | Authors: | Kumaran, D., Grosjean, N., Blaby, E.C. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 9b1c | | Status: | HPUB -- hold until publication | | Title: | CTX-M-15 WT in complex with BLIP E73W | | Authors: | Rivera, P., Lu, S., Palzkill, T., Sankaran, B., Prasad, V. | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 9b18 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-13 |
|
| PDBID: | 9fp4 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 9bd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-11 |
|
| PDBID: | 9bej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9fpp | | Status: | HPUB -- hold until publication | | Title: | FGD2 (Rv0132c) from Mycobacterium tuberculosis with cofactor F420 crystallised with Anderson-Evans polyoxotungstate | | Authors: | Aderemi, A., Snee, M., Levy, C., Leys, D. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 9bns | | Status: | HPUB -- hold until publication | | Title: | Rhesus macaque ITS114.01 Fab in complex with SIV MPER peptide | | Authors: | Gorman, J., Lai, Y.-T., Kwong, P.D. | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9fex | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-21 |
|
| PDBID: | 9boc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9fhh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-27 |
|
| PDBID: | 9bob | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-03 |
|
| PDBID: | 9fq3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9bci | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-09 |
|
| PDBID: | 9fpx | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of DYRK1A in complex with Curcumin | | Authors: | Grygier, P., Pustelny, K., Czarna, A. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9bjz | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Deposition date: | 2024-04-26 |
|
| PDBID: | 9fqb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zsq | | Status: | HPUB -- hold until publication | | Title: | Respirasome closed state 1 bound by metformin (SC-MetC1) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-06-05 |
|
| PDBID: | 9fq1 | | Status: | HPUB -- hold until publication | | Title: | Structure of the disease-causing mutant P20S of human KCTD1 | | Authors: | Balasco, N., Ruggiero, A., Smaldone, G., Esposito, L., Berisio, R., Vitagliano, L. | | Deposition date: | 2024-06-14 | | Sequence: | >Entity 1
MSRPLITRSPASPLNNQGISTPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQQRGFEIVGSCGGGVDSSQFSEYVLRRELRRTPRVPSVIRIKQEPLD
|
|
| PDBID: | 9fq4 | | Status: | HPUB -- hold until publication | | Title: | Glyceraldehyde 3-phosphate dehydrogenase A (GAPDHA) NADP holoenzyme, from Helicobacter pylori, with active site cysteine oxidised to sulfenic acid | | Authors: | Foster, S.P., Moody, P.C.E. | | Deposition date: | 2024-06-14 |
|
| PDBID: | 9bi3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-22 |
|
