| PDBID: | 8wwc | | Status: | HPUB -- hold until publication | | Title: | De novo design binder of HRAS -120-4 | | Authors: | Wang, L., Wang, S., Liu, Y. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 8jgs | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of apo state mClC-3_I607T | | Authors: | Wan, Y.Z.Q., Yang, F. | | Deposition date: | 2023-05-21 | | Release date: | 2024-08-28 |
|
| PDBID: | 8wwg | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N. | | Deposition date: | 2023-10-25 |
|
| PDBID: | 9cxb | | Status: | HPUB -- hold until publication | | Title: | Native human GABAA receptor of beta2-alpha1-beta1-alpha2-gamma2 assembly | | Authors: | Jia, Z., Ryan, H., Colleen, N. | | Deposition date: | 2024-07-31 |
|
| PDBID: | 9cxc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wx6 | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A C240S/C393S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8jhd | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-05-23 | | Release date: | 2024-10-23 |
|
| PDBID: | 9cxd | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wx9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9cxh | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wwz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9cxx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wx1 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9cxg | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wxc | | Status: | HPUB -- hold until publication | | Title: | X-Ray crystal structure of glycoside hydrolase family 6 cellobiohydrolase from Phanerochaete chrysosporium PcCel6A D170N/C240S/C393S | | Authors: | Yamaguchi, S., Sunagawa, N., Tachioka, M., Igarashi, K. | | Deposition date: | 2023-10-28 |
|
| PDBID: | 9cxi | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wzo | | Status: | HPUB -- hold until publication | | Title: | Parkin in complex with phospho NEDD8 | | Authors: | Lenka, D.R., Kumar, A. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 9cxj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wzn | | Status: | HPUB -- hold until publication | | Title: | ParkinK211N in complex with phospho NEDD8 | | Authors: | Lenka, D.R., Kumar, A. | | Deposition date: | 2023-11-02 |
|
| PDBID: | 9cxm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8wzs | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of SRCRD11 of human DMBT1 from needle-shape crystal | | Authors: | Zhang, C., Lu, P., Nagata, K. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
TAGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGHESYLWSCPHNGWLSHNCGHHEDAGVICSASQSQPTPS
|
|
| PDBID: | 9cxn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8x86 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
| PDBID: | 9cxo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-31 |
|
| PDBID: | 8x8a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-27 |
|
