| PDBID: | 9f49 | | Status: | HOLD -- hold until a certain date | | Title: | Structure of the bacteriophage K gp155 C-terminal domain, seleno-methionine modified version | | Authors: | Pichel, A., van Raaij, M.J. | | Deposition date: | 2024-04-26 | | Release date: | 2024-06-21 | | Sequence: | >Entity 1
KDF(MSE)LIGHRGATGYTDEHTIKGYQ(MSE)ALDKGADYIELDLQLTKDNKLLC(MSE)HDSTIDRTTTGTGKVGD(MSE)TLSYIQTNFTSLNGEPIPSLDDVLNHFGTKVKYYIETKRPFDAN(MSE)DRELLTQLKAKGLIGIGSERFQVIIQSFARESLINIHNQFSNIPLAYLTSTFSESE(MSE)DDCLSYGFYAIAPKYTTITKELVDLAHSKGLKVHAWTVNTKEE(MSE)QSLIQ(MSE)GVDGFFTNYLDEYKKI
|
|
| PDBID: | 8yyw | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OXGR1 bound to alpha-ketoglutarate and Gq proteins | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8fvn | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-08-01 |
|
| PDBID: | 9f4c | | Status: | HPUB -- hold until publication | | Title: | Structure of the C-terminal domain of CKAP5/chTOG | | Authors: | Pfuhl, M. | | Deposition date: | 2024-04-27 | | Sequence: | >Entity 1
ASRIDEKSSKAKVNDFLAEIFKKIGSKENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVERGLRVIEMEREGKGRISTSTGISPQMEVTCVPTPTSTVSSIGNTNGEEVGPSVYLERLKILRQRCGLDNTKQDDRP
|
|
| PDBID: | 8yyx | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of OXGR1 bound to leukotriene E4 and Gq proteins | | Authors: | Liu, A., Liu, Y. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8fvo | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-08-03 |
|
| PDBID: | 8yyp | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PtmB in complex with cyclo-(L-Trp-L-Trp) and Adenine | | Authors: | Zhang, Z.Y., Qu, X.D., Duan, B.R., Wei, G.Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f58 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-28 |
|
| PDBID: | 9f4i | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8fvp | | Status: | HOLD -- hold until a certain date | | Title: | PCSK9 in complex with an inhibitor | | Authors: | Xu, M., Chopra, R. | | Deposition date: | 2023-01-19 | | Release date: | 2024-08-03 |
|
| PDBID: | 8yym | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f57 | | Status: | HPUB -- hold until publication | | Title: | Identification of chloride ions in lysozyme. | | Authors: | Duman, R., El Omari, K., Forsyth, I., Wagner, A. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8yyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with one insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f59 | | Status: | HPUB -- hold until publication | | Title: | Poliovirus type 2 (strain MEF-1) stabilised virus-like particle (PV2 SC6b) from a mammalian expression system. | | Authors: | Bahar, M.W., Porta, C., Fry, E.E., Stuart, D.I. | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8yyy | | Status: | HPUB -- hold until publication | | Title: | Viral protein | | Authors: | Suzuki, T., Yanagi, Y., Hashiguchi, T. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f5a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8yyt | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with four insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f5i | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-28 |
|
| PDBID: | 8yys | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the complex IR with two insulin | | Authors: | Xi, Z. | | Deposition date: | 2024-04-04 |
|
| PDBID: | 9f5j | | Status: | HPUB -- hold until publication | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant Q58I | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8yyz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-04 |
|
| PDBID: | 8cae | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Crystal structure of SARS-CoV-2 Mpro-H172Y mutant in complex with nirmatrelvir | | Authors: | El Kilani, H., Hilgenfeld, R. | | Deposition date: | 2023-01-24 |
|
| PDBID: | 9f5l | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | SARS-CoV-2 Nucleocapsid N-terminal domain (NTD) mutant A119S | | Authors: | Dhamotharan, K., Schlundt, A. | | Deposition date: | 2024-04-29 |
|
| PDBID: | 8yz2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-05 |
|
| PDBID: | 8fxw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-01-25 | | Release date: | 2024-12-31 |
|
