| PDBID: | 8wc2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-11 | | Release date: | 2025-03-11 |
|
| PDBID: | 8qht | | Status: | HPUB -- hold until publication | | Title: | Leishmania braziliensis PRMT1-PRMT3 heterotetrameric complex in unliganded form. | | Authors: | Levdikov, V., Nay, E., Walrad, P., Plevin, J.M. | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 | | Sequence: | >Entity 1
DYYFDSYSHYGIHMEMLKDYHRTTTYRDAIWRNAYMFKDKVVLDVGCGTGILSMFAARAGARKVIGIDCSNVAVQARQIVQDNGFSDIITIIQGKVEELDLDEKVDIIISEWMGYFLLYESMLNTVLYARDRWGASDVKILPSSANMYACGITDPQYVEQKFNIWNSVNGLDFSYFKRLSYIEPLIDTVNPEQIITDIVPFFSFDINRVTEAELSFTSTFTLEAKQGDFVHAISVHFDTPFYAGHDPVVLNTSPMVPPTHWRQTVLYMFHPLIMKRGEKANFTMKCAPNPGNPRDLDISLHIDFDGELQACHYDQDFRLR
>Entity 2
SAARISSNISTIHDHQRLRAYEVIFRNVRGKTLLHLGCGMGLYSMLAARGMAKMVIGIDSSAIVDAARVVAEQNGLKNIQFIRGRLCEALHQLPSDMKFDYVLCEWMGPLLLNERVLTDALYARDHLLTESGALCPNRASLHVVAVSDYAFRLDTEDFWSNVYGFQMEPMKELVRQEVEMCAIPGSNIVSAPCLAHTIHMDTLEGLTAEETATYEAQANQAAAIRDNEEENPVEHCWVPAAVAQKGYEAAFTLSIARSATVHYLTFYLDAAFTSKTNPGANFVLAVRPGGQNNWTEVSVGLREPLPVNAGEKIQGTVRVYTPAEKGGKVTVVEVTAKTAGQVAAIETFGTYYYQSY
|
|
| PDBID: | 8qhu | | Status: | HPUB -- hold until publication | | Title: | CRYO-EM STRUCTURE OF LEISHMANIA MAJOR 80S RIBOSOME : LM32Cs1C1 snoRNA overexpression | | Authors: | Rajan, K.S., Yonath, A., Bashan, A. | | Deposition date: | 2023-09-10 | | Release date: | 2024-12-09 |
|
| PDBID: | 8u4g | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8u4m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbw | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-10 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 | | Release date: | 2025-03-10 |
|
| PDBID: | 8wbi | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-09 | | Release date: | 2025-03-10 |
|
| PDBID: | 8qhn | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Streptococcus pyogenes GapN in complex with NADPH and erythrose-4-phosphate | | Authors: | Wirsing, R., Schindelin, H. | | Deposition date: | 2023-09-08 |
|
| PDBID: | 8qhf | | Status: | HPUB -- hold until publication | | Title: | Corynebacterium glutamicum mycoloyltransferase C acyl-enzyme intermediate | | Authors: | Li de la Sierra-Gallay, I., Lesur, E. | | Deposition date: | 2023-09-08 | | Release date: | 2025-03-08 |
|
| PDBID: | 8u40 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of main protease of SARS-CoV-2 complexed with inhibitor | | Authors: | Chen, P., Arutyunova, E., Lu, J., Young, H.S., Lemieux, M.J. | | Deposition date: | 2023-09-08 | | Release date: | 2025-03-05 |
|
| PDBID: | 8qha | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 | | Release date: | 2025-03-07 |
|
| PDBID: | 8qhb | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 | | Release date: | 2025-03-07 |
|
| PDBID: | 8u35 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 | | Release date: | 2025-02-06 |
|
| PDBID: | 8u38 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-09-07 |
|
| PDBID: | 8u34 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 | | Release date: | 2025-02-06 |
|
| PDBID: | 8wah | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-07 | | Release date: | 2025-03-10 |
|
| PDBID: | 8qgz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 8qgx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-06 |
|
| PDBID: | 8u2n | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The cryo-EM structure of Pseudomonas phage vB_PaeM_C2-10_Ab1 neck (portal:H-t-T:collar:gateway) | | Authors: | Li, F., Cingolani, G. | | Deposition date: | 2023-09-06 | | Release date: | 2025-03-12 |
|
| PDBID: | 8u2h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
