| PDBID: | 8tq5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tq2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8tqc | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-08-06 | | Release date: | 2025-02-05 |
|
| PDBID: | 8kbc | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-21 |
|
| PDBID: | 8kbg | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-21 |
|
| PDBID: | 8kbh | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-21 |
|
| PDBID: | 8kbj | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2024-08-21 |
|
| PDBID: | 8kbn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbo | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbp | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbr | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbs | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbt | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8kbu | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8toy | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-04 | | Release date: | 2025-02-04 |
|
| PDBID: | 8tog | | Status: | HPUB -- hold until publication | | Title: | X-Ray Structure Determination of Dihydromethanopterin Reductase (DmrA) from Methylobacterium extorquens AM1 in a P6522 Space Group at a Resolution of 1.56 Angstroms | | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbing, M., Collazo, M.J., Potla, S. | | Deposition date: | 2023-08-03 | | Release date: | 2025-01-08 | | Sequence: | >Entity 1
MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
| PDBID: | 8q2f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-07 |
|
| PDBID: | 8q2h | | Status: | HPUB -- hold until publication | | Title: | beta-galactosidase from Bacillus circulans | | Authors: | Kascakova, B., Hovorkova, M., Petraskova, L., Novacek, J., Pinkas, D., Gardian, Z., Kren, V., Bojarova, P., Kuta Smatanova, I. | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-02 |
|
| PDBID: | 8q2i | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2025-02-02 |
|
| PDBID: | 8to4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2024-08-14 |
|
| PDBID: | 8to3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-02 | | Release date: | 2024-08-14 |
|
| PDBID: | 8tn4 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, used to study poly-N-acetyl-glucosamine broadly expressed in biofilm-forming pathogenclonal antibody | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 8tn7 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a disaccharide | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGE
|
|
