| PDBID: | 9rjt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjz | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rj1 | | Status: | HPUB -- hold until publication | | Title: | S-methylcysteine synthase (BSAS4) from common bean in complex with PLP, BEZ, and GOL | | Authors: | Witek, W., Jaskolski, M., Ruszkowski, M. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjb | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Human Signal Peptidase in complex with artificial Signal Peptide L11 | | Authors: | Liaci, A.M., Vismpas, D., Skalidis, I., Koh, F.A., Abhay, K., Forster, G.F. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjg | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin (compound 1) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rk0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjc | | Status: | HPUB -- hold until publication | | Title: | Apo Structure of the Human Signal Peptidase | | Authors: | Liaci, A.M., Vismpas, D., Skalidis, I., Koh, F.A., Abhay, K., Forster, G.F. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rk2 | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | Cryo-EM structure of ScV-L-A virus | | Authors: | Novoa, G., Gil-Cantero, D., Caston, J.R. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjh | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin-derivative KV26a (compound 4) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rji | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin-derivative KV29a (compound 5) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjj | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV37a (compound 9) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjk | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV41a (compound 11) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjl | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV35a (compound 12) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rja | | Status: | PROC -- to be processed | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rj4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 | | Sequence: | >Entity 1
GPGMSSLGTVDAPNFIVGNPWDDKLIFKLLSGLSKPVSSYPNTFEWQCKLPAIKPKTEFQLGSKLVYVHHLLGEGAFAQVYEATQGDLNDAKNKQKFVLKVQKPANPWEFYIGTQLMERLKPSMQHMFMKFYSAHLFQNGSVLVGELYSYGTLLNAINLYKNTPEKVMPQGLVISFAMRMLYMIEQVHDCEIIHGDIKPDNFILGNGFLEQDDEDDLSAGLALIDLGQSIDMKLFPKGTIFTAKCET(SEP)GFQCVEMLSNKPWNYQIDYFGVAATVYCMLFGTYMKVKNEGGECKPEGLFRRLPHLDMWNEFFHVMLNIPDCHHLPSLDLLRQKLKKVFQQHYTNKIRALRNRLIVLLLECKRSRK
|
|
| PDBID: | 9rje | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Chlamydomonas reinhardtii Histone Deacetylase 11 (HDAC11) in complex with hexanoic acid | | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rj2 | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjm | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative EP196 (compound 13) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjn | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV32a (compound 14) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjd | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Leptospira interrogans Histone deacetylase 11 (HDAC11) in complex with Dodec-4-enoic acid | | Authors: | Novakova, Z., Schenkmayerova, A., Motlova, L., Barinka, C. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjp | | Status: | HPUB -- hold until publication | | Title: | Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative KV25a (compound 15) | | Authors: | Publicola, G., Mourey, L., Valderrama, K., Hartkoorn, R., Maveyraud, L. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rj9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rj6 | | Status: | HPUB -- hold until publication | | Title: | Zn Finger DNA complex | | Authors: | Yao, Y.M., OHagan, M.P., Onoon, K., Givon, L., Rogotner-Hamer, S., Kessler, N., Dym, O., Pipatpolkai, T., Schumacher, M.A., Afek, A. | | Deposition date: | 2025-06-12 |
|
| PDBID: | 9rjq | | Status: | HPUB -- hold until publication | | Title: | [FeFe]-hydrogenase CpI from Clostridium pasteurianum, variant Q195L | | Authors: | Duan, J., Liu, L., Hofmann, E., Happe, T. | | Deposition date: | 2025-06-12 |
|
