PDBID: | 8tqy | Status: | HPUB -- hold until publication | Title: | X-Ray Crystal Structure of a dihydromethanopterin reductase (DmrA) from Methylobacterium extorquens AM1 in a H32 Spacegroup at 2.19 Angstrom Resolution | Authors: | Axelrod, H.L., Rasche, M.E., Cascio, D., Arbig, M., Collazo, M., Potla, P.S. | Deposition date: | 2023-08-08 | Release date: | 2025-01-08 | Sequence: | >Entity 1 MIDVRCICAIGQRGQLGLNGHLPWEGNTDPLFVEDVTRFFALTMGHVLIAGPKTVASVPEFAFKDRTIDVIRSHEDPEAVLKRYPGRRIFVGGGIAVWNVYAKYIQHWDVTRLPYDGEADRWFDPAWLVGGPLRHHHHHH
|
|
PDBID: | 9bj3 | Status: | HPUB -- hold until publication | Title: | Structure of the SARS-CoV-2 S 6P trimer complex with the human neutralizing antibody Fab fragment, C1596 | Authors: | Rubio, A.A., Abernathy, M.E., Barnes, C.O. | Deposition date: | 2024-04-24 |
|
PDBID: | 9bix | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8v39 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9b83 | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-28 |
|
PDBID: | 8v3g | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9b89 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human ADAR1 in complex with dsRNA derived from HT2C gene in the pre-editing state | Authors: | Deng, X., Gao, Y. | Deposition date: | 2024-03-29 |
|
PDBID: | 8v3a | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 8v35 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-27 |
|
PDBID: | 9bfz | Status: | HPUB -- hold until publication | Title: | Tri-complex of Compound-5, KRAS G12C, and CypA | Authors: | Tomlinson, A.C.A., Saldajeno-Concar, M., Knox, J.E., Yano, J.K. | Deposition date: | 2024-04-18 |
|
PDBID: | 8tw4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-20 |
|
PDBID: | 9bg3 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-18 |
|
PDBID: | 9bfv | Status: | HPUB -- hold until publication | Title: | Tri-complex of Compound-19, KRAS G12C, and CypA | Authors: | Tomlinson, A.C.A., Knox, J.E., Yano, J.K. | Deposition date: | 2024-04-18 |
|
PDBID: | 8ulr | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of the BG505 SOSIPv2 in complex with bNAb 05_B08 Fabs | Authors: | DeLaitsch, A.T., Bjorkman, P.J. | Deposition date: | 2023-10-16 |
|
PDBID: | 9bfx | Status: | HPUB -- hold until publication | Title: | Tri-complex of RMC-6291, KRAS G12C, and CypA | Authors: | Tomlinson, A.C.A., Saldajeno-Concar, M., Knox, J.E., Yano, J.K. | Deposition date: | 2024-04-18 |
|
PDBID: | 8uyb | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 8uyc | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 9bg0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-18 |
|
PDBID: | 8uy4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-13 |
|
PDBID: | 9bgd | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-18 |
|
PDBID: | 9bk0 | Status: | HPUB -- hold until publication | Title: | TEM-1 WT in complex with BLIP E73W | Authors: | Rivera, P., Lu, S., Sankaran, B., Prasad, B.V.V., Palzkill, T.G. | Deposition date: | 2024-04-26 |
|
PDBID: | 8ull | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-16 |
|
PDBID: | 9bbf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-05 |
|
PDBID: | 8ulo | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-16 |
|
PDBID: | 9bbc | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-05 |
|