| PDBID: | 9b6k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-25 |
|
| PDBID: | 8v16 | | Status: | HPUB -- hold until publication | | Title: | Esterase with a monomeric cooperative, hysteresis or allokairy | | Authors: | Guzzo, C.R., Vinces, T.G.C., Visnardi, A.B. | | Deposition date: | 2023-11-19 |
|
| PDBID: | 8v1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 |
|
| PDBID: | 8v1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQCGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 8v1c | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I3 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9auq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of 4-Fluoro-tryptophan labeled Oscillatoria Agardhii agglutinin | | Authors: | Runge, B.R., Zadorozhnyi, R.R., Quinn, C.M., Russell, R.W., Lu, M., Antolinez, S., Struppe, J., Schwieters, C.D., Byeon, I.L., Hadden-Perilla, J., Gronenborn, A.M., Polenova, T. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8v1d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of GPX4-R152H in presence of DEL-I25 | | Authors: | Forouhar, F., Liu, H., Stockwell, B.R. | | Deposition date: | 2023-11-20 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMLEAASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQ(OCS)GKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFAAGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKHYGPMEEPLVIEKDLPHYF
|
|
| PDBID: | 9aur | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9b2e | | Status: | HPUB -- hold until publication | | Title: | DHNA associated with an inhibitor | | Authors: | Czeczot, A.M., Silva, E.E.D., Timmers, L.F.S.M., Machado, P., Basso, L.A., Bizarro, C.V. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 9b2k | | Status: | HPUB -- hold until publication | | Title: | SpCas9 with dual-guide RNA in open conformation | | Authors: | Korolev, S., Gagnon, K. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8v5u | | Status: | HPUB -- hold until publication | | Title: | Human SIRT3 bound to p53-AMC peptide and Honokiol | | Authors: | Chakrabarti, R., Ghosh, A., Guan, X., Upadhyay, A., Dumpati, R.K., Munshi, S., Roy, S., Chall, S., Rahnamoun, A., Reverdy, C., Errasti, G., Delacroix, T. | | Deposition date: | 2023-12-01 | | Sequence: | >Entity 1
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
>Entity 2
QPK(FDL)
|
|
| PDBID: | 9b6v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v25 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b6w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v23 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of HIV-1 capsid N-terminal domain in the presence of Lenacapavir | | Authors: | Briganti, L., Kvaratskhelia, M. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9b6x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-26 |
|
| PDBID: | 8v1x | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of polyketide synthase (PKS) thioreductase domain from Streptomyces coelicolor | | Authors: | Pereira, J.H., Dan, Q., Keasling, J., Adams, P.D. | | Deposition date: | 2023-11-21 |
|
| PDBID: | 9ave | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial fission 1 protein Fis1 T34E mutation | | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 8v2x | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the reconstruction of the worst case of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by bayesian inference | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2023-11-24 |
|
| PDBID: | 8v3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9b3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 8v3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 8v3x | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
| PDBID: | 9awy | | Status: | HPUB -- hold until publication | | Title: | Structure of full-length amyloidogenic immunoglobulin light chain H9 in complex with 3-(2-(4-(3-ethyl-3-phenylpyrrolidin-1-yl)-6-methyl-2-oxopyridin-1(2H)-yl)ethyl)-8-(imidazo[1,5-a]pyrazin-8-yl)-1,3,8-triazaspiro[4.5]decan-2-one | | Authors: | Lederberg, O.L., Kelly, J.W., Yan, N.L., Wilson, I.A., Stanfield, R.L. | | Deposition date: | 2024-03-05 |
|
| PDBID: | 8v3y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-28 |
|
