PDBID: | 9gci | Status: | AUTH -- processed, waiting for author review and approval | Title: | The crystal structure of beta-glucosidase from the thermophilic bacterium Caldicellulosiruptor saccharolyticus determined at 1.47 A resolution | Authors: | Chrysina, E.D., Sotiropoulou, A.I. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gch | Status: | AUTH -- processed, waiting for author review and approval | Title: | Human mitochondrial RNAseZ with tRNA-His-CCA | Authors: | Valentin Gese, G., Hallberg, B.M. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcg | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcf | Status: | PROC -- to be processed | Title: | HUMAN PI3KDELTA IN COMPLEX WITH ISOCUMARIN INHIBITOR CHF-6523 | Authors: | Pala, D., Bruno, P., Capelli, A.M., Biagetti, M. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gce | Status: | HPUB -- hold until publication | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcd | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH Fulacimstat (COMPOUND86) | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcc | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND47 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gcb | Status: | HPUB -- hold until publication | Title: | Structure of IsDUF4198 | Authors: | Franco Cairo, J.P.L., Correa, T.L.R., Offen, W.A., Nairn, A., Walton, J., Davies, G.J., Walton, P.H. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gca | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C8H8N2O | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc9 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND27 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-08-01 | Sequence: | >Entity 1 MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
PDBID: | 9gc7 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc6 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | Authors: | Hargreaves, D. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc5 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | Authors: | Hargreaves, D. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc4 | Status: | WAIT -- processing started, waiting for author input to continue processing | Title: | Highly optimized CNS penetrant inhibitors of EGFR Exon20 Insertion Mutations | Authors: | Hargreaves, D. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc3 | Status: | WAIT -- processing started, waiting for author input to continue processing | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc2 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Cryo-EM structure of Arabidopsis thaliana PSI-LHCI- a603-NH mutant | Authors: | Capaldi, S., Chaves-Sanjuan, A., Bonnet, D.M.V., Bassi, R. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc1 | Status: | AUTH -- processed, waiting for author review and approval | Title: | CRYSTAL STRUCTURE OF HUMAN CHYMASE IN COMPLEX WITH COMPOUND8 | Authors: | Schaefer, M., Fuerstner, C. | Deposition date: | 2024-08-01 |
|
PDBID: | 9gc0 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbz | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-31 |
|
PDBID: | 9gby | Status: | AUTH -- processed, waiting for author review and approval | Title: | Crystal structure of Pseudomonas aeruginosa IspD | Authors: | Borel, F., D''Auria, L. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbw | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbv | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | E.coli gyrase holocomplex with chirally wrapped 217 bp DNA fragment | Authors: | Michalczyk, E., Ghilarov, D. | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbu | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-31 |
|
PDBID: | 9gbt | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-31 |
|