PDBID: | 9atl | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-27 |
|
PDBID: | 8ubq | Status: | HPUB -- hold until publication | Title: | EcDsbA soaked with N-(2-fluorophenyl)-5-methylisoxazole-3-carboxamide and 2-benzyl-4-phenylthiazole-5-carboxylic acid | Authors: | Wang, G., Heras, B. | Deposition date: | 2023-09-24 | Sequence: | >Entity 1 AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
PDBID: | 9aty | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-27 |
|
PDBID: | 8ubt | Status: | HPUB -- hold until publication | Title: | Structure of SCF-FBXL17-BACH1BTB E3 ligase complex | Authors: | Shi, H., Cao, S. | Deposition date: | 2023-09-24 |
|
PDBID: | 9atw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-27 |
|
PDBID: | 9atz | Status: | HPUB -- hold until publication | Title: | HIV 16055.v8.3 SOSIP Env in Complex with V2 Epitope and Anti-Immune Complex pAbs from Rabbit 2464 | Authors: | Brown, S., Antansijevic, A., Ward, A.B. | Deposition date: | 2024-02-27 |
|
PDBID: | 8ubv | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of dimeric FBXL17-BACH1BTB E3 ubiquitin ligase complex | Authors: | Shi, H., Cao, S., Zheng, N. | Deposition date: | 2023-09-25 |
|
PDBID: | 9aua | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8uc7 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 9aub | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8uc8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-25 |
|
PDBID: | 9au6 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8ucj | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 8uck | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9au5 | Status: | HPUB -- hold until publication | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a cognate G:C base pair | Authors: | Li, C., Gao, Y. | Deposition date: | 2024-02-28 |
|
PDBID: | 8ucl | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9au4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8ucm | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9au8 | Status: | HPUB -- hold until publication | Title: | Ternary complex of human DNA polymerase theta polymerase domain with a mismatched T:T base pair | Authors: | Li, C., Gao, Y. | Deposition date: | 2024-02-28 |
|
PDBID: | 8ucn | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9au7 | Status: | HPUB -- hold until publication | Title: | Human Retriever VPS35L/VPS29/VPS26C complex bound to SNX17 peptide (Composite Map) | Authors: | Chen, B., Chen, Z., Han, Y., Boesch, D.J., Juneja, P., Burstein, E., Fung, H.Y.J. | Deposition date: | 2024-02-28 |
|
PDBID: | 8uco | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9au9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-28 |
|
PDBID: | 8ucp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-26 |
|
PDBID: | 9auq | Status: | HPUB -- hold until publication | Title: | Crystal structure of 4-Fluoro-tryptophan labeled Oscillatoria Agardhii agglutinin | Authors: | Runge, B.R., Zadorozhnyi, R.R., Quinn, C.M., Russell, R.W., Lu, M., Antolinez, S., Struppe, J., Schwieters, C.D., Byeon, I.L., Hadden-Perilla, J., Gronenborn, A.M., Polenova, T. | Deposition date: | 2024-02-29 |
|