| PDBID: | 8ziy | | Status: | HPUB -- hold until publication | | Title: | trypsinogen-EP-E574A | | Authors: | Song, Q.Y., Ding, Z.Y., Huang, H.J. | | Deposition date: | 2024-05-14 |
|
| PDBID: | 8rt0 | | Status: | HPUB -- hold until publication | | Title: | BTV-15 VP5 pH 6.0 | | Authors: | Stuart, D.I., Sutton, G.C. | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8zcu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-30 |
|
| PDBID: | 8rsp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8zk3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-15 |
|
| PDBID: | 8rsq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8zno | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Arachis hypogaea bc1 complex | | Authors: | Ye, Y., Dong, J.Q., Yang, G.F. | | Deposition date: | 2024-05-27 |
|
| PDBID: | 8rss | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 | | Sequence: | >Entity 1
MEELTYRLFMVATVGMLAGTVFLLASSREVKPEHRRGVYISALVCGIAWYHYQKMGASWESGSYDTGLRYVDWVLTVPLMFVEVLAVTRKGAAYNEAVRNWGIAATVMIGAGYYGETSAAGSNEYWTGFVIAMATYVWLMRNLQAEGEGLKGDQAVAFENIKNLILVGWIIYPLGYIAPVVGDFDAIREVLYTIADIIN(LYR)VGLGVLVLQMARVQSGEKVS
|
|
| PDBID: | 8znk | | Status: | HPUB -- hold until publication | | Title: | chromone glycosyltransferase (UGT93BB1,SdUGT2) | | Authors: | Zou, J.L., Li, H.Y., Wang, Z.L., Ye, M. | | Deposition date: | 2024-05-27 |
|
| PDBID: | 8s8m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-06 |
|
| PDBID: | 8zok | | Status: | HPUB -- hold until publication | | Title: | EcGPR tetramer with catalytic intermediates | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8rg6 | | Status: | HPUB -- hold until publication | | Title: | Arginase 2 in complex with inhibitor | | Authors: | Petersen, J. | | Deposition date: | 2023-12-13 |
|
| PDBID: | 8zoh | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-7VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8r6v | | Status: | HPUB -- hold until publication | | Title: | The complex of glycogen phosphorylase with EGCG (epigallocatechin gallate) and caffeine. | | Authors: | Alexopoulos, S., Papakostopoulou, S., Koulas, M.S., Leonidas, D.D., Skamnaki, V. | | Deposition date: | 2023-11-23 |
|
| PDBID: | 9j0d | | Status: | HPUB -- hold until publication | | Title: | Apo structure of ketoreductase AsuC7 from Asukamycin polyketide Synthases | | Authors: | Dai, Y., Qu, X. | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8zoi | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-5VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8rl2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-02 |
|
| PDBID: | 8zoj | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-28 |
|
| PDBID: | 8s2g | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-17 |
|
| PDBID: | 8r4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8zkz | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the Drosophila INDY (apo-asymmetric, pH8) | | Authors: | Kim, S., Park, J.G., Choi, S.H., Kim, J.W., Jin, M.S. | | Deposition date: | 2024-05-17 |
|
| PDBID: | 9j0a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-08-02 |
|
| PDBID: | 8r4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8zov | | Status: | HPUB -- hold until publication | | Title: | The crystal structures of MurK in complex with glucose from Clostridium acetobutylicum | | Authors: | Yang, X.Y., Liu, X.H. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 8rlt | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
