| PDBID: | 8z65 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the hGPR4-Gs complex in pH7.2 | | Authors: | Zhong, Y.N., Guo, L.L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 9gc8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Pseudomonas aeruginosa IspD in complex with C11H12N2O3 | | Authors: | Borel, F., D''Auria, L. | | Deposition date: | 2024-08-01 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMTTSDLPAFWTVIPAAGVGSRMRADRPKQYLDLAGRTVIERTLDCFLEHPMLRGLVVCLAEDDPYWPGLDCAASRHVQRAAGGAERAGSVLNGLLRLLELGAQADDWVLVHDAARPNLTRGDLDRLLEELAEDPVGGLLAVPARDTLKRSDRDGRVSETIDRSVVWLAYTPQMFRLGALHRALADALVAGVAITDEASAMEWAGYAPKLVEGRADNLKITTPEDLLRLQRSFPHLE
|
|
| PDBID: | 8rvf | | Status: | HPUB -- hold until publication | | Title: | CRYSTAL STRUCTURE OF HUMAN MONOGLYCERIDE LIPASE IN COMPLEX WITH COMPOUND 5 | | Authors: | Leibrock, L., Hentsch, A., Nazare, M., Grether, U., Kuhn, B., Blaising, J., Benz, J. | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8rvh | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 8z5e | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8rso | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-25 |
|
| PDBID: | 8z5v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8z5o | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8rw0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the adenosine A2A receptor in complex with Istradefylline | | Authors: | Glover, H. | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8z69 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the second bromodomain of human BRD2 BD2 in complex with the inhibitor Y13195 | | Authors: | Li, J., Hu, Q., Xu, H., Zhao, X., Zhang, C., Zhu, R., Wu, X., Zhang, Y., Xu, Y. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8rw4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8z62 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8rw7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 9ion | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-09 |
|
| PDBID: | 8z6a | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of SARS-CoV-2 D614G S with three ACE2 receptors binding (RB3) in prefusion conformation | | Authors: | Liu, Z., Xing, L. | | Deposition date: | 2024-04-18 |
|
| PDBID: | 8rwc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8z12 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of WT DiatB | | Authors: | Peng, M., Wu, Q.L. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8rvz | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-02 |
|
| PDBID: | 8rtm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8z0s | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of trimer HtmB2-CT | | Authors: | Sun, Y.H., Zhang, Z.Y., Mei, Q. | | Deposition date: | 2024-04-10 |
|
| PDBID: | 9ip5 | | Status: | HPUB -- hold until publication | | Title: | Hemichannel sub-structure of Cx36/GJD2 gap junction intercellular channel (FN conformation) in brain polar lipid nanodiscs, treated with a 14-fold molar excess of carbenoxolone | | Authors: | Jang, H.S. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 8rtl | | Status: | HPUB -- hold until publication | | Title: | Af Aio C65F-C80G | | Authors: | Engrola, F., Romao, M.J., Correia, M., Santos-Silva, T. | | Deposition date: | 2024-01-26 |
|
| PDBID: | 8z0x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8z0w | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-10 |
|
| PDBID: | 8rtp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-27 |
|
