PDBID: | 8qg9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qga | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgb | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 8qgc | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgg | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgh | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgi | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgj | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzv | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgk | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xza | Status: | HPUB -- hold until publication | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgl | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8qgm | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgn | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzw | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgo | Status: | HPUB -- hold until publication | Title: | Crystal structure of NAD kinase 1 from Listeria monocytogenes in complex with a di-adenosine derivative | Authors: | Gelin, M., Labesse, G., Lionne, C. | Deposition date: | 2023-09-05 |
|
PDBID: | 8xzk | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-11 |
|
PDBID: | 8xzl | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 8qgq | Status: | HPUB -- hold until publication | Deposition date: | 2023-09-05 | Release date: | 2025-03-09 |
|