PDBID: | 8xzc | Status: | HPUB -- hold until publication | Title: | Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (PM20D2) Tyr314Phe mutant | Authors: | Chandravanshi, K., Kumar, A., Makde, R.D. | Deposition date: | 2024-01-21 |
|
PDBID: | 9f26 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the PriS_PriL-Rpa2WH ternary complex from P. abyssi | Authors: | Madru, C., Legrand, P., Haouz, A., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzu | Status: | HPUB -- hold until publication | Title: | HosA transcriptional regulator from enteropathogenic Escherichia coli O127:H6 (strain E2348/69) bound with 4-hydroxy benzoic acid - Conformation II at 2.33 angstrom resolution | Authors: | Manjunath, K., Goswami, A. | Deposition date: | 2024-01-21 | Sequence: | >Entity 1 MALRNKAFHQLRQLFQQHTARWQHELPDLTKPQYAVMRAIADKPGIEQVALIEAAVSTKATLAEMLARMENRGLVRREHDAADKRRRFVWLTAEGEKVLAAAIPIGDSVDEEFLGRLSAEEQELFMQLVRKMMNTLEHHHHHH
|
|
PDBID: | 9f28 | Status: | HPUB -- hold until publication | Title: | Crystal structure of the heterodimeric primase from pyrococcus abyssi (deletion of the PriL-CTD domain) | Authors: | Madru, C., Sauguet, L. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzz | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f22 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP1 (3G190.24) | Authors: | Mittl, P.R., Winkelvoss, D. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzy | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f23 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP2 (2G156) | Authors: | Mittl, P.R., Hansen, S. | Deposition date: | 2024-04-22 |
|
PDBID: | 9f24 | Status: | HPUB -- hold until publication | Title: | DARPin eGFP complex DP4 (2G71) | Authors: | Mittl, P.R., Winkelvoss, D. | Deposition date: | 2024-04-22 |
|
PDBID: | 8xza | Status: | HPUB -- hold until publication | Title: | BA.2.86 Spike in complex with bovine ACE2 (Local refinement) | Authors: | Yue, C., Liu, P. | Deposition date: | 2024-01-21 |
|
PDBID: | 9f2c | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 9f25 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8y00 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f2b | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-22 |
|
PDBID: | 8xzs | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-21 |
|
PDBID: | 9f2d | Status: | HPUB -- hold until publication | Title: | KIR2DL1 bound to RIFIN RBK21 | Authors: | Chamberlain, S.G., Higgins, M.K. | Deposition date: | 2024-04-22 |
|
PDBID: | 8y0i | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 9f2h | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8y03 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 9f2i | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8y04 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8q16 | Status: | HPUB -- hold until publication | Deposition date: | 2023-07-30 | Release date: | 2024-10-30 |
|
PDBID: | 9f2g | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-23 |
|
PDBID: | 8y05 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|
PDBID: | 8y06 | Status: | HPUB -- hold until publication | Deposition date: | 2024-01-22 |
|