| PDBID: | 8yqn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-19 | | Release date: | 2025-03-19 |
|
| PDBID: | 9fpc | | Status: | HOLD -- hold until a certain date | | Title: | Architectural insights into the corrin and metal binding sites of CobN cobaltochelatase | | Authors: | Pickersgill, R.W. | | Deposition date: | 2024-06-13 | | Release date: | 2024-12-13 | | Sequence: | >Entity 1
DSRAVPTPAAWELGKKSAELLITRYTQDHGEWPTSFGLTAWGTSNMRTGGDDIAQALALIGVQPVWDMASRRVTGYEIVPPAKLARPRVDVTLRISGFFRDAFPEQIALFDKAVRAVGALDEDVEDNPIAARMKAEQARLVAGGADPQTAERRAGYRVFGSKPGAYGAGLQALIDENGWAGRNDLAEAWLVWGGYAYGAGEEGQAERGLLEERLRSVQAVVQNQDNREHDLLDSDDYYQFEGGMAATVESLTGAMPSVYHNDHSRPEKPVIRALEEELSRVVRGRAANPKWIAGVMRHGYKGAAEIAATVDYLFAFAATTGKVGNHHFEAVYQAYIADRAVHDFMAEKNPAALAETAAKLNEAIERGFWTPRSNSARFELENLS
|
|
| PDBID: | 8qog | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of the yeast SPT-Orm2-Monomer complex | | Authors: | Schaefer, J., Koerner, C., Moeller, A., Froehlich, F. | | Deposition date: | 2023-09-28 | | Release date: | 2024-09-28 |
|
| PDBID: | 8qj1 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-09-12 | | Release date: | 2024-09-12 |
|
| PDBID: | 8jqm | | Status: | HOLD -- hold until a certain date | | Title: | CryoEM structure of sNS1 complexed with Fab 4F10 | | Authors: | Chen, Q., Qi, P. | | Deposition date: | 2023-06-14 | | Release date: | 2024-12-01 |
|
| PDBID: | 9f2q | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-23 | | Release date: | 2025-04-23 |
|
| PDBID: | 8qku | | Status: | HOLD -- hold until a certain date | | Title: | SWR1-nucleosome complex in configuration 1 | | Authors: | Jalal, A.S.B., Wigley, D.B. | | Deposition date: | 2023-09-18 | | Release date: | 2024-09-18 |
|
| PDBID: | 8jxr | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-01 | | Release date: | 2025-01-01 |
|
| PDBID: | 8jxs | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-07-01 | | Release date: | 2025-01-01 |
|
| PDBID: | 9eyz | | Status: | HOLD -- hold until a certain date | | Title: | membrane complex from Haemophilus influenzae - conformation B | | Authors: | Castro, D.K.S.V., Delepelaire, P., Biou, V. | | Deposition date: | 2024-04-10 | | Release date: | 2025-04-10 |
|
| PDBID: | 8qtn | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-12 | | Release date: | 2024-10-12 |
|
| PDBID: | 8jr7 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-16 | | Release date: | 2024-12-25 |
|
| PDBID: | 9f1p | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-04-19 | | Release date: | 2025-04-19 |
|
| PDBID: | 8yry | | Status: | HOLD -- hold until a certain date | | Title: | HER3 in complex with FAb Hu3f8 | | Authors: | Wang, M., Li, X. | | Deposition date: | 2024-03-22 | | Release date: | 2025-03-22 |
|
| PDBID: | 8y2n | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-26 | | Release date: | 2025-01-26 |
|
| PDBID: | 8yml | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-03-09 | | Release date: | 2025-03-09 |
|
| PDBID: | 8jse | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-19 | | Release date: | 2024-12-19 |
|
| PDBID: | 8jra | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-06-16 | | Release date: | 2024-12-25 |
|
| PDBID: | 8q6v | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-08-15 | | Release date: | 2024-08-15 |
|
| PDBID: | 8xul | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-13 | | Release date: | 2025-01-13 |
|
| PDBID: | 9fim | | Status: | HOLD -- hold until a certain date | | Title: | compound 1 bound KMT9 crystal structure | | Authors: | Sheng, W., Eric, M., Roland, S. | | Deposition date: | 2024-05-29 | | Release date: | 2025-05-29 |
|
| PDBID: | 9fk1 | | Status: | HOLD -- hold until a certain date | | Title: | The structure of glycosynthase XT6 (E265G mutant), the extracellular xylanase of G.proteiniphilus T-6 | | Authors: | Hadad, N., Chmelnik, O., Dessau, M., Shoham, Y., Shoham, G. | | Deposition date: | 2024-06-01 | | Release date: | 2025-06-01 |
|
| PDBID: | 8xz4 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-20 | | Release date: | 2025-01-20 |
|
| PDBID: | 8kig | | Status: | HOLD -- hold until a certain date | | Title: | Cryo-EM structure of MC3R in complex with SHU9119 | | Authors: | Chen, Q., Fu, J. | | Deposition date: | 2023-08-23 | | Release date: | 2025-02-23 |
|
| PDBID: | 8xz5 | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2024-01-20 | | Release date: | 2025-01-20 |
|
