PDBID: | 9g0t | Status: | HPUB -- hold until publication | Title: | Xenopus tropicalis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0s | Status: | HPUB -- hold until publication | Title: | Xenopus tropicalis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0r | Status: | HPUB -- hold until publication | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 4-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0q | Status: | HPUB -- hold until publication | Title: | Xenopus laevis undecorated microtubule - 15 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0p | Status: | HPUB -- hold until publication | Title: | Xenopus laevis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0o | Status: | HPUB -- hold until publication | Title: | Xenopus borealis undecorated microtubule - 14 protofilament, 3-start helix | Authors: | Troman, L.A., Moores, C.A. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0n | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 299K | Authors: | Horvath, D. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0m | Status: | HPUB -- hold until publication | Title: | Trp-cage fortified Tc5b-Exenatide chimera (Ex4-Tc5bER) at 288K | Authors: | Horvath, D. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0l | Status: | HPUB -- hold until publication | Title: | Crystal structure of the RING-ZnF1 fragment of SIAH1 | Authors: | Coste, F., Suskiewicz, M.J. | Deposition date: | 2024-07-08 | Sequence: | >Entity 1 MTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSIRNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPLEHHHHHH
|
|
PDBID: | 9g0j | Status: | HPUB -- hold until publication | Title: | Structure of the PRO-PRO endopeptidase (PPEP-3) from Geobacillus thermodenitrificans | Authors: | Claushuis, B., Wojtalla, F., van Leeuwen, H., Corver, J., Baumann, U., Hensbergen, P. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0i | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0h | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0g | Status: | HPUB -- hold until publication | Title: | BsCdaA in complex with Compound 7 | Authors: | Neumann, P., Ficner, R. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0f | Status: | HPUB -- hold until publication | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0e | Status: | PROC -- to be processed | Title: | CryoEM structure of PmcTnsC-dsDNA-AMPPNP in complex with PmcTnsAB hook | Authors: | Finocchio, G., Chanez, C., Querques, I., Speichert, K.J., Jinek, M. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0d | Status: | HPUB -- hold until publication | Title: | Structure of human Mical1 bMERB_V978A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0c | Status: | HPUB -- hold until publication | Title: | Structure of human Mical1 bMERB_V978A_V985A domain:Rab10 complex. | Authors: | Rai, A., Goody, R.S. | Deposition date: | 2024-07-08 |
|
PDBID: | 9g0a | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-07 |
|
PDBID: | 9g09 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-07 |
|
PDBID: | 9g08 | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2024-07-07 |
|
PDBID: | 9g07 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-07 |
|
PDBID: | 9g06 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | Structure of 30S-IF1-IF3-mRNA-fMet-tRNA-GE81112A complex | Authors: | Safdari, H.A., Morici, M., Wilson, D.N. | Deposition date: | 2024-07-07 |
|
PDBID: | 9g05 | Status: | HPUB -- hold until publication | Title: | Structure of MadB, a class I dehydrates from Clostridium maddingley, in complex with its substrate | Authors: | Knospe, C.V., Ortiz, J., Reiners, J., Kedrov, A., Gerten, C., Smits, S.H.J., Schmitt, L. | Deposition date: | 2024-07-07 |
|
PDBID: | 9g04 | Status: | HPUB -- hold until publication | Title: | Structure of MadB, a class I dehydrates from Clostridium maddingley in the apo state | Authors: | Knospe, C.V., Ortiz, J., Reiners, J., Kedrov, A., Gertzen, C., Smits, S.H.J., Schmitt, L. | Deposition date: | 2024-07-06 |
|
PDBID: | 9g03 | Status: | HPUB -- hold until publication | Deposition date: | 2024-07-06 |
|