| PDBID: | 8us9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9b2f | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NAD+ | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 8us7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9b2h | | Status: | HPUB -- hold until publication | | Title: | HIV-1 wild type protease with GRL-072-17A, a substituted tetrahydrofuran derivative based on Darunavir as P2 group | | Authors: | Wang, Y.-F., Agniswamy, J., Ghosh, A.K., Weber, I.T. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYDQIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
| PDBID: | 8us0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9b2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of short chain dehydrogenase reductase 9 (short chain dehydrogenase reductase 9C4) in complex with NADH | | Authors: | Pakhomova, S., Belyaeva, O.V., Boeglin, W.E., Kedishvili, N.Y., Brash, A.R., Newcomer, M.E., Popov, K.M. | | Deposition date: | 2024-03-15 | | Sequence: | >Entity 1
MLFWLLALLFLCAFLWNYKGQLKIADIADKYVFITGCDTGFGNLAARTFDKKGFRVIAACLTESGSAALKAKTSERLHTVLLDVTDPENVKKTAQWVKSHVGEKGLWGLINNAGVLGVLAPTDWLTVDDYREPIEVNLFGLINVTLNMLPLVKKARGRVINVSSIGGRLAFGGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFKTELADPIKTTEKKLAIWKHLSPDIKQQYGEGYIEKSLHRLKSNTSSVNLDLSLVVGCMDHALTSLFPKTRYIAGKDAKTFWIPLSHMPAVLQDFLLLKQKVELANPKAV
|
|
| PDBID: | 8usn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 8us8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9b2e | | Status: | HPUB -- hold until publication | | Title: | DHNA associated with an inhibitor | | Authors: | Czeczot, A.M., Silva, E.E.D., Timmers, L.F.S.M., Machado, P., Basso, L.A., Bizarro, C.V. | | Deposition date: | 2024-03-15 |
|
| PDBID: | 8utc | | Status: | HPUB -- hold until publication | | Title: | HUMAN LEUKOCYTE ANTIGEN B*07:02 IN COMPLEX WITH SARS-COV2 EPITOPE N105-113 (Y111F mutant) | | Authors: | Oltean, N., Nyovanie, S., Hashem, A., Patskovska, L., Patskovsky, Y., Krogsgaard, M. | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8utz | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b2t | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8uu0 | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 6 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b2u | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8uu1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b2r | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-16 |
|
| PDBID: | 8uti | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with Reh1 and A/P site tRNA | | Authors: | Yelland, J.N., Taylor, D.W., Johnson, A.W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b2x | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8uu2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b2v | | Status: | HPUB -- hold until publication | | Title: | SARS CoV-2 Spike protein Ectodomain with internal tag, 1RBD-up conformation | | Authors: | Singh, S., Hasan, S.S. | | Deposition date: | 2024-03-17 |
|
| PDBID: | 8uu3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uth | | Status: | HPUB -- hold until publication | | Title: | Active site binding triggers E1-rearrangements revealing E1-E2 lipoyl domain interactions in the Pyruvate dehydrogenase complex | | Authors: | Arjunan, P., Whitley, M., Furey, W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 9b3a | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b31 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
| PDBID: | 9b32 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-18 |
|
