| PDBID: | 8zvs | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8uhk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8zvx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8uhx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8uhy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-09 |
|
| PDBID: | 8zw0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8zw4 | | Status: | HPUB -- hold until publication | | Title: | TLR7 in complex with GUC-v1 (RR) | | Authors: | Zhang, Z., Ohto, U., Shimizu, T. | | Deposition date: | 2024-06-12 |
|
| PDBID: | 8zwo | | Status: | HPUB -- hold until publication | | Title: | Structure of CTF18-PCNA with ATP | | Authors: | Briola, G.R., Tehseen, M., Al-Amodi, A., Nguyen, P.Q., Savva, C.G., Hamdan, S.M., De Biasio, A. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8ulv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8zwg | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of JR14a bound C3aR-Gi complex | | Authors: | Luo, P., Xu, Y., Xu, H.E. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8ujc | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8zwa | | Status: | HPUB -- hold until publication | | Title: | HopBY induced At EDS1-PAD4-ADR1 heterotrimer | | Authors: | Xu, W.Y., Zhang, Y., Yu, H., Wan, L. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8ujd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8ujq | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-11 |
|
| PDBID: | 8um5 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of human SHIP1 Ptase-C2 domains covalently bound to TREAT-AD (TAD) compound TAD-58547 | | Authors: | Mesecar, A.D., Hamdani, A.K. | | Deposition date: | 2023-10-17 | | Sequence: | >Entity 1
SMEQPEPDMITIFIGTWNMGNAPPPKKITSWFLSKGQGKTRDDSADYIPHDIYVIGTQEDPLSEKEWLEILKHSLQEITSVTFKTVAIHTLWNIRIVVLAKPEHENRISHICTDNVKTGIANTLGNKGAVGVSFMFNGTSLGFVNSHLTSGSEKKLRRNQNYMNILRFLALGDKKLSPFNITHRFTHLFWFGDLNYRVDLPTWEAETIIQKIKQQQYADLLSHDQLLTERREQKVFLHFEEEEITFAPTYRFERLTRDKYAYTKQKATGMKYNLPSWCDRVLWKSYPLVHVVCQSYGSTSDIMTSDHSPVFATFEAGVTSQFVSKNGPGTVDSQGQIEFLRCYATLKTKSQTKFYLEFHSSCLESFVKSQEGENEEGSEGELVVKFGETLPKLKPIISDPEYLLDQHILISIKSSDSDESYGEGCIALRLEATETQLPIYTPLTHHGELTGHFQGEIKLQTSQ
|
|
| PDBID: | 8umf | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-17 |
|
| PDBID: | 8zx1 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E.Coli membrane protein | | Authors: | Qiao, Z., Gao, Y.G. | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8ukc | | Status: | HPUB -- hold until publication | | Title: | Solution NMR Structure of the lasso peptide chlorolassin | | Authors: | Saad, H., Zhu, L., Harris, L.A., Shelton, K.E., Mitchell, D.A. | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8uk8 | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of the C. neoformans lipid flippase Apt1-Cdc50 complex with occluded butyrolactol A in the E2P state | | Authors: | Duan, H.D., Li, H. | | Deposition date: | 2023-10-12 |
|
| PDBID: | 8zx4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8zx5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-13 |
|
| PDBID: | 8ukn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-14 |
|
| PDBID: | 8tn5 | | Status: | HPUB -- hold until publication | | Title: | The Crystal Structure of a human monoclonal antibody (aAb), termed TG10, complexed with a GlcNH2 | | Authors: | Li, M., Wlodawer, A., Temme, S., Gildersleeve, J. | | Deposition date: | 2023-08-01 | | Sequence: | >Entity 1
EVQLVESGGGLVQPGGSLRLSCAVSGFPFSSYWMSWVRQAPGKGLEWVANIKEDGSEKYYVDSVKGRFTISRDNAKNSLYLQMNSLRAEDTAVYYCATDPDVGLSDSWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
>Entity 2
EIVLTQSPGTLSLSPGDRATHSCRASQSVSRSYLAWYQQKPGQTPRLFIYGASNRATGIPDRFSGSGSGTYFTLTISRLEPEDFAVYYCQQYDSAPDTFGQGTRLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
|
|
| PDBID: | 8zxb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-14 |
|
| PDBID: | 8zxd | | Status: | HPUB -- hold until publication | | Title: | the Planar Cell Polarity Core Protein Vangl1 | | Authors: | Zhang, F., Chen, S. | | Deposition date: | 2024-06-14 |
|
