| PDBID: | 8us5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9be7 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant dTRAP without Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 8usn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9be8 | | Status: | HPUB -- hold until publication | | Title: | Alkalihalobacillus halodurans (Aha) trp RNA binding attenuation protein (TRAP) mutant T49A/T52A dTRAP with Trp | | Authors: | Yang, H., Stachowski, K., Foster, M. | | Deposition date: | 2024-04-15 | | Sequence: | >Entity 1
MNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFTEHTSAVKIRGKAIIQTSYGTLDTEKDEGGGGSGGGGSMNVGDNSNFFVIKAKENGVNVFGMTRGTDTRFHHSEKLDKGEVMIAQFAEHASAVKIRGKAIIQTSYGTLDTEKDEENLYFQ
|
|
| PDBID: | 8us8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-27 |
|
| PDBID: | 9bec | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bef | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8B, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8usy | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9beh | | Status: | HPUB -- hold until publication | | Title: | Structure of GH110A in complex with galactose-6-sulfate | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-15 |
|
| PDBID: | 9bej | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8usz | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9bek | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-15 |
|
| PDBID: | 8usv | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 8utd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-30 |
|
| PDBID: | 9beq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 8utz | | Status: | HPUB -- hold until publication | | Title: | E3 ubiquitin-protein ligase CBL-B in complex with compound 2 | | Authors: | Gajewski, S., Clifton, M.C. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uus | | Status: | HPUB -- hold until publication | | Title: | Structure of Serratia proteamaculans antifeeding prophage Fibre foot domain (AfpX13) | | Authors: | Young, P.G., Hurst, M.R.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 9bf5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 8uuj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-01 |
|
| PDBID: | 9bf3 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 9bep | | Status: | HPUB -- hold until publication | | Title: | Structure of S1_8C, a lambda-carrageenan specific sulfatase, in complex with an oligosaccharide | | Authors: | Hettle, J.A., Vickers, C., Boraston, A.B. | | Deposition date: | 2024-04-16 |
|
| PDBID: | 8uvd | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-02 |
|
| PDBID: | 9bet | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
| PDBID: | 8uv2 | | Status: | HPUB -- hold until publication | | Title: | Human p97/VCP structure with a triazole inhibitor (NSC799462/hexamer) | | Authors: | Nandi, P., DeVore, K., Chiu, P.-L. | | Deposition date: | 2023-11-02 | | Sequence: | >Entity 1
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG
|
|
| PDBID: | 9ben | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-16 |
|
