| PDBID: | 8u1a | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-31 |
|
| PDBID: | 9aze | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u1p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-01 |
|
| PDBID: | 9azf | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of pneumococcal surface antigen PsaA in the Ni-bound state | | Authors: | Ngu, D.H.Y., Luo, Z.Y., Kobe, B., McDevitt, C.A. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9b06 | | Status: | HPUB -- hold until publication | | Title: | Mycolicibacterium smegmatis ClpS with LeuThr dipeptide and Mg2+ | | Authors: | Presloid, C.J., Jiang, J., Beardslee, P.C., Anderson, H.R., Swayne, T.M., Schmitz, K.R. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u1y | | Status: | HPUB -- hold until publication | | Title: | E.coli DsbA in complex with N-(4-(thiophen-3-yl)benzyl)cyclohexanamine | | Authors: | Wang, G., Heras, B. | | Deposition date: | 2023-09-04 | | Sequence: | >Entity 1
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKMTKYHVNFMGGDLGKDLTQAWAVAMALGVEDKVTVPLFEGVQKTQTIRSASDIRDVFINAGIKGEEYDAAWNSFVVKSLVAQQEKAAADVQLRGVPAMFVNGKYQLNPQGMDTSNMDVFVQQYADTVKYLSEKK
|
|
| PDBID: | 9azt | | Status: | HPUB -- hold until publication | | Title: | CH67 Fab bound to A/Massachusetts/1/1990 influenza hemagglutinin head with a G189E mutation (1) | | Authors: | Maurer, D.P., Schmidt, A.G. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 9azn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u2l | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of KAI2 S95C L48I mutant | | Authors: | Davies, S.F., Waters, M.T., Bond, C.S. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
GVVEEAHNVKVIGSGEATIVLGHGFGTDQSVWKHLVPHLVDDYRVVIYDNMGAGTTNPDYFDFDRYSNLEGYSFDLIAILEDLKIESCIFVGH(OCS)VSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLNQLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDMRQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRNDI
|
|
| PDBID: | 9ivv | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human secretory glutaminyl cyclase in complex with the inhibitor 3-((2-(1H-imidazol-5-yl)ethyl)carbamoyl)-4-amino-1,2,5-oxadiazole 2-oxide | | Authors: | Li, G.-B., Yu, J.-L., Zhou, C., Ning, X.-L., Mou, J., Wu, J.-W., Meng, F.-B. | | Deposition date: | 2024-07-24 |
|
| PDBID: | 9azc | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u2f | | Status: | HPUB -- hold until publication | | Title: | Vibrio parahaemolyticus ToxS periplasmic domain | | Authors: | Kim, M., Kull, F.J., Midgett, C.R. | | Deposition date: | 2023-09-06 | | Sequence: | >Entity 1
MSDLKVEQVLTSNEWQSTMVTVITDNLPDDTVGPLRRVNVESNVKYLPNGDYIRVSNIKLFAQGSTAESTINISEKGRWEVSDNYLLVSPSEFKDISSSQSKDFSEAQLRLITQIFKLDAEQSRRIDVVNEKTLLLTSLNHGSTVLFRN
|
|
| PDBID: | 9azm | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 9azv | | Status: | HPUB -- hold until publication | | Title: | CH67 Fab bound to A/Massachusetts/1/1990 influenza hemagglutinin head with a G189E mutation (2) | | Authors: | Maurer, D.P., Schmidt, A.G. | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u2h | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinlinato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 8u2g | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human LC3A soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 9azu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u2j | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of human GABARAPL2 soaked with RAHQ-C [Ru(p-cymene)(N,O-8-hydroxyquinolato)Cl] | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 9azw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-11 |
|
| PDBID: | 8u2i | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL2 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 9b0d | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
| PDBID: | 8u2k | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of human GABARAPL1 soaked with RAPTA-C | | Authors: | Eade, L., Sullivan, M.P., Hartinger, C.G., Goldstone, D.C. | | Deposition date: | 2023-09-06 | | Release date: | 2025-02-28 |
|
| PDBID: | 9b0t | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of E227Q variant of uMtCK1 in complex with transition state analog | | Authors: | Demir, M., Koepping, L., Zhao, J., Sergienko, E. | | Deposition date: | 2024-03-12 |
|
| PDBID: | 9b13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-03-12 |
|
