| PDBID: | 8si1 | | Status: | HPUB -- hold until publication | | Title: | Ara h 6 16A8 complex | | Authors: | Spiller, B.W., Shrem, R.A. | | Deposition date: | 2023-04-14 | | Release date: | 2025-01-17 |
|
| PDBID: | 9c5z | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8syx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-05-26 | | Release date: | 2024-11-20 |
|
| PDBID: | 9c6d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of mutant NonPro1 Tautomerase Superfamily Member 8U6-S1P in complex with 3-bromopropiolate inhibitor | | Authors: | Hardtke, H.A., Venkat Ramani, M.K., Zhang, Y.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9gqw | | Status: | HPUB -- hold until publication | | Title: | Ligand binding domain of the Pectobacterium atrosepticum SCRI1043 high-affinity chemoreceptor for malate | | Authors: | Gavira, J.A., Krell, T., Monteagudo-Cascales, E., Pineiro-Pineiro, J. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9c6a | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated adenosine deaminase Cad1-CARF in the apo form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9gqz | | Status: | HPUB -- hold until publication | | Title: | Interaction with AK2A links AIFM1 to cellular energy metabolism. The cryo-EM structure of dimeric AIFM1 engaged to MIA40. | | Authors: | Rothemann, R.A., Pavlenko, E.A., Gerlich, S., Grobushkin, P., Mostert, S., Stobbe, D., Racho, J., Stillger, K., Lapacz, K., Petrungaro, C., Dengjel, J., Neundorf, I., Bano, D., Mondal, M., Weiss, K., Ehninger, D., Nguyen, T.H.D., Poepsel, S.P., Riemer, J. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9c69 | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated CARF-adenosine deaminase, Cad1-CARF in the cA4 bound form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8til | | Status: | HPUB -- hold until publication | | Title: | Human ACKR3 phosphorylated by GRK5 in complex with Arrestin3 reconstructed without receptor/micelle | | Authors: | Chen, Q., Tesmer, J.J.G. | | Deposition date: | 2023-07-19 | | Release date: | 2025-01-22 |
|
| PDBID: | 9gr4 | | Status: | HPUB -- hold until publication | | Title: | The MKA-RSL - sulfonato-calix[4]arene complex | | Authors: | Mockler, N.M., Ramberg, K.O., Flood, R.J., Crowley, P.B. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9c68 | | Status: | HPUB -- hold until publication | | Title: | The CRISPR associated CARF-adenosine deaminase Cad1-CARF in the cA6 bound form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8tmb | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CorA in complex with conformation-specific synthetic antibody C12 and 20 mM MgCl2, State MG20-1 | | Authors: | Erramilli, S.K., Perozo, E., Kossiakoff, A.A. | | Deposition date: | 2023-07-29 | | Release date: | 2025-01-31 |
|
| PDBID: | 9gr0 | | Status: | HPUB -- hold until publication | | Title: | Interaction with AK2A links AIFM1 to cellular energy metabolism. The cryo-EM structure of dimeric AIFM1 bound by AK2A. | | Authors: | Rothemann, R.A., Pavlenko, E.A., Gerlich, S., Grobushkin, P., Mostert, S., Stobbe, D., Racho, J., Stillger, K., Lapacz, K., Petrungaro, C., Dengjel, J., Neundorf, I., Bano, D., Mondal, M., Weiss, K., Ehninger, D., Nguyen, T.H.D., Poepsel, S.P., Riemer, J. | | Deposition date: | 2024-09-10 |
|
| PDBID: | 9c63 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9c64 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8tsk | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 | | Release date: | 2025-02-11 |
|
| PDBID: | 9c65 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 | | Sequence: | >Entity 1
STLEVRSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREGSGRQADNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
|
|
| PDBID: | 9grg | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-09-11 |
|
| PDBID: | 9grk | | Status: | HPUB -- hold until publication | | Title: | Cdc42 Binding peptide (W14A) | | Authors: | Mott, H.R., Murphy, N.P., Owen, D. | | Deposition date: | 2024-09-11 |
|
| PDBID: | 9c6b | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-06-07 |
|
| PDBID: | 8u25 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of SARS-CoV-2 Main Protease (Mpro) L50F/E166A/L167F Triple Mutant | | Authors: | Kohaal, N., Lewandowski, E.M., Wang, J., Chen, Y. | | Deposition date: | 2023-09-05 |
|
| PDBID: | 9c67 | | Status: | HPUB -- hold until publication | | Title: | cryoEM structure of CRISPR associated effector, CARF-Adenosine deaminase 1, Cad1, in apo form | | Authors: | Majumder, P., Patel, D.J. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9grl | | Status: | HPUB -- hold until publication | | Title: | Cdc42 binding peptide (W14A) with homocysteine | | Authors: | Mott, H.R., Owen, D., Murphy, N.P. | | Deposition date: | 2024-09-11 |
|
| PDBID: | 9c6h | | Status: | HPUB -- hold until publication | | Title: | [d3] Tensegrity triangle with deazapurine center strand (strand 3) in R3 | | Authors: | Vecchioni, S., Sha, R., Ohayon, Y., Galindo, M., Lopez-Chamorro, C., Jong, M. | | Deposition date: | 2024-06-07 |
|
| PDBID: | 9gr8 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of the N-terminal kinase domain from Saccharomyces cerevisiae Vip1 in complex with ADP. | | Authors: | Lee, K., Raia, P., Hothorn, M. | | Deposition date: | 2024-09-11 |
|
