| PDBID: | 8tru | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9itk | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9au6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-28 |
|
| PDBID: | 8trx | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-10 |
|
| PDBID: | 9itl | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9aus | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9itn | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9aud | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 8tse | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-11 |
|
| PDBID: | 9ito | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9aut | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9aug | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3.G57R | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9itq | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9its | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9auu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9auh | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA3 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9itu | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 8tt9 | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | | Deposition date: | 2023-08-13 | | Sequence: | >Entity 1
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
| PDBID: | 9itv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9aui | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of CH848.d949.10.17.GS-DH270.UCA4 | | Authors: | Zhang, Q.E., Acharya, P. | | Deposition date: | 2024-02-29 |
|
| PDBID: | 9avb | | Status: | HPUB -- hold until publication | | Title: | Fis1 Wild type | | Authors: | Mathes, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9itx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9ity | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
| PDBID: | 9avd | | Status: | HPUB -- hold until publication | | Title: | Mitochondrial fission 1 protein Fis1 structure T34D mutation | | Authors: | Mathews, I.I., Pokhrel, S., Wakatsuki, S. | | Deposition date: | 2024-03-01 |
|
| PDBID: | 9iu0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-20 |
|
