PDBID: | 8za9 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8zaa | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-24 |
|
PDBID: | 8trw | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 | Release date: | 2025-02-10 |
|
PDBID: | 8zab | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of ectodomains of HBMBPP-BTN2A1-BTN3A1 complex | Authors: | Zheng, J., Gao, W., Zhu, Y., Huang, Z. | Deposition date: | 2024-04-24 |
|
PDBID: | 8tru | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8zay | Status: | HPUB -- hold until publication | Title: | Crystal structure of Fab | Authors: | Adachi, Y., Nogi, T. | Deposition date: | 2024-04-25 |
|
PDBID: | 8trx | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-10 |
|
PDBID: | 8zau | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zb0 | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tsk | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-11 | Release date: | 2025-02-11 |
|
PDBID: | 8zac | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zad | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zae | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zaf | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zag | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tt9 | Status: | HPUB -- hold until publication | Title: | X-ray structure of Macrophage Migration Inhibitory Factor (MIF) Covalently Bound to 4-hydroxyphenylpyruvate (HPP) | Authors: | Schroder, G.C., Meilleur, F., Nix, J.C., Crichlow, G.V., Lolis, E.J. | Deposition date: | 2023-08-13 | Sequence: | >Entity 1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
PDBID: | 8zaj | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8ttq | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-14 |
|
PDBID: | 8ttr | Status: | HPUB -- hold until publication | Title: | CA9 mimic bound to SH7 | Authors: | Peat, T.S. | Deposition date: | 2023-08-14 |
|
PDBID: | 8zai | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8tts | Status: | HPUB -- hold until publication | Title: | OXA-48 in complex with CDD-2201 | Authors: | Park, S., Su, L., Taylor, D., Sun, Z., Ramana, S., Chamakuri, S., Qin, X., Tan, Z., Sharma, K., Li, F., Fan, J., Hu, L., Sankaran, B., Prasad, B.V.V., Matzuk, M., Palzkill, T. | Deposition date: | 2023-08-15 |
|
PDBID: | 8zal | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zas | Status: | HPUB -- hold until publication | Deposition date: | 2024-04-25 |
|
PDBID: | 8zb6 | Status: | HPUB -- hold until publication | Title: | Yeast-expressed polio type 2 stabilized virus-like particles | Authors: | Hong, Q., Cong, Y. | Deposition date: | 2024-04-26 |
|
PDBID: | 8tu8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-08-15 |
|