PDBID: | 8ylr | Status: | HPUB -- hold until publication | Title: | State 6 (S6) of yeast 80S ribosome bound to 2 tRNAs and eEF2 and eEF3 during tranlocation | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | Deposition date: | 2024-03-06 |
|
PDBID: | 8rbl | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-04 |
|
PDBID: | 8rbp | Status: | HPUB -- hold until publication | Title: | Crystal structure of chimeric human carbonic anhydrase IX with 4-chloro-2-(cyclohexylsulfanyl)-N-(2-hydroxyethyl)-5-sulfamoylbenzamide | Authors: | Manakova, E.N., Smirnov, A., Paketuryte, V., Grazulis, S. | Deposition date: | 2023-12-04 | Sequence: | >Entity 1 MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVEFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKALQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTKGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK
|
|
PDBID: | 8yld | Status: | HPUB -- hold until publication | Title: | State 4a (S4a) of yeast 80S ribosome bound to 2 tRNAs and open eEF3 and eEF2 during translocation | Authors: | Cheng, J., Wu, C.L., Li, J.X., Zhang, X.Z. | Deposition date: | 2024-03-06 |
|
PDBID: | 8rby | Status: | HPUB -- hold until publication | Title: | The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the neutralizing nanobody 1.26 | Authors: | Casasnovas, J.M., Fernandez, L.A., Silva, K. | Deposition date: | 2023-12-05 |
|
PDBID: | 8yli | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rc2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-05 |
|
PDBID: | 8ylj | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rbw | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-05 |
|
PDBID: | 8ylf | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rc3 | Status: | HPUB -- hold until publication | Title: | DNA bound type IV-A1 CRISPR effector complex from P. oleovorans | Authors: | Miksys, A., Cepaite, R., Malinauskaite, L., Pausch, P. | Deposition date: | 2023-12-05 |
|
PDBID: | 8ylg | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rca | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-06 |
|
PDBID: | 8ylk | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rc8 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-06 |
|
PDBID: | 8yll | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rc9 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-06 |
|
PDBID: | 9il3 | Status: | HPUB -- hold until publication | Title: | Crystal structure of human malectin in complex with glucose | Authors: | Si, Y.L. | Deposition date: | 2024-06-29 |
|
PDBID: | 8ylm | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rcb | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-06 |
|
PDBID: | 8ylt | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-06 |
|
PDBID: | 8rcc | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-06 |
|
PDBID: | 8rci | Status: | HPUB -- hold until publication | Title: | Human p53 DNA-binding domain bound to DARPin C10 | Authors: | Balourdas, D.I., Muenick, P., Strubel, A., Knapp, S., Dotsch, V., Joerger, A.C., Structural Genomics Consortium (SGC) | Deposition date: | 2023-12-06 |
|
PDBID: | 8ylv | Status: | HPUB -- hold until publication | Deposition date: | 2024-03-07 |
|
PDBID: | 8rc6 | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of hexameric BTB domain of Drosophila CG6765 protein | Authors: | Bonchuk, A.N., Naschberger, A., Baradaran, R. | Deposition date: | 2023-12-06 | Sequence: | >Entity 1 AENYHLKWDSHLTYLNSSIATLYKNEKFADVVLYSSYNSSGIPSDIPTVGISAHKFILSASSQFFATMFETAPITNPNGVLYVVLPPDLSHRAIQILVQYMYSGEATVSNDILNEVLRGGEILKIRGLCRT
|
|