PDBID: | 8ycv | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-18 |
|
PDBID: | 9fsi | Status: | HPUB -- hold until publication | Title: | NMR solution structure of synthetic hexapeptide | Authors: | Geyer, A., Vazquez, O. | Deposition date: | 2024-06-21 |
|
PDBID: | 8qww | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQWL from Tc5b, grown from 10% ethanol without TFA | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 8ycy | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpC1P1P2 complex bound to bortezomib, conformation 3 | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qwv | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQNL, grown in the presence of ethanol | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 8ycx | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpC1P1P2 complex bound to bortezomib, conformation 2 | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qwu | Status: | HPUB -- hold until publication | Title: | Structure of the amyloid-forming peptide LYIQNL, grown without ethanol | Authors: | Durvanger, Z. | Deposition date: | 2023-10-20 |
|
PDBID: | 8yd0 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpXP1P2 complex bound to bortezomib | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-18 |
|
PDBID: | 8qx3 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-21 |
|
PDBID: | 8ycw | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-18 |
|
PDBID: | 8qx4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-22 |
|
PDBID: | 9iiu | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of an TEF30-associated intermediate PSII core complex from Chlamydomonas reinhardtii | Authors: | Wang, Y., Wang, C., Li, A., Liu, Z. | Deposition date: | 2024-06-21 |
|
PDBID: | 8qx6 | Status: | HPUB -- hold until publication | Title: | Novel laminarin-binding CBM X584 | Authors: | Zuehlke, M.K., Jeudy, A., Czjzek, M. | Deposition date: | 2023-10-22 | Sequence: | >Entity 1 DFALPINFGADIEYTTGANSVPFEVVTNPEQSGINATDTKVGKVTNQGGQYEALTFLLDEAIDFSGSNKTITMKVYSEVAYQVLFKLETGMNGERANEVEVSHSGNGWEELSFNFNNARNSFVQGDDANNGQPFVPTGQYDEISIFLDFAGFTAGDFYIDDIEQN
|
|
PDBID: | 8yda | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-19 |
|
PDBID: | 8yd4 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-19 |
|
PDBID: | 9iir | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-21 |
|
PDBID: | 8yd1 | Status: | HPUB -- hold until publication | Title: | CryoEM structure of M. tuberculosis ClpC1P1P2 complex bound to bortezomib, conformation 1 | Authors: | Zhou, B., Gao, Y., Zhao, H., Chen, X., He, J., Zhang, T., Xiong, X. | Deposition date: | 2024-02-19 |
|
PDBID: | 8yd2 | Status: | HPUB -- hold until publication | Deposition date: | 2024-02-19 |
|
PDBID: | 8yd9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of p38alpha with an allosteric inhibitor 3 | Authors: | Hasegawa, S., Kinoshita, T. | Deposition date: | 2024-02-19 |
|
PDBID: | 9ij7 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-21 |
|
PDBID: | 8qxc | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-24 |
|
PDBID: | 9ij8 | Status: | HPUB -- hold until publication | Deposition date: | 2024-06-21 |
|
PDBID: | 8qy2 | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-25 |
|
PDBID: | 8ydh | Status: | HPUB -- hold until publication | Title: | E.coli transcription translation coupling complex in TTC-P state 1 (subclass1) containing mRNA with 39-mer spacer, NusG, NusA, fMet-tRNA(iMet), Phe-tRNA(Phe), and viomycin | Authors: | Zhang, J., Lu, G., Wang, C., Lin, J. | Deposition date: | 2024-02-20 |
|
PDBID: | 8qxz | Status: | HPUB -- hold until publication | Deposition date: | 2023-10-25 |
|