| PDBID: | 8zoh | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-7VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 9g26 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 8qm2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zoi | | Status: | HPUB -- hold until publication | | Title: | Structure of the astaxanthin mutant PSI-5VCPI supercomplex in Nannochloropsis oceanica | | Authors: | Shen, L.L., Shen, J.R., Wang, W.D. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 9g2h | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 8qm4 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zom | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of pyraclostrobin-bound Arachis hypogaea bc1 complex | | Authors: | Cui, G.R., Wang, Y.X., Yang, G.F. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 9g1v | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 |
|
| PDBID: | 8qm5 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zon | | Status: | HPUB -- hold until publication | | Title: | EcGPR at close conformation. | | Authors: | Zhang, T., Leng, Q., Liu, L.J. | | Deposition date: | 2024-05-28 |
|
| PDBID: | 9g1t | | Status: | HPUB -- hold until publication | | Title: | Human LTC4 synthase in complex with compound 5 | | Authors: | Srinivas, H. | | Deposition date: | 2024-07-10 |
|
| PDBID: | 8qm6 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zpa | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 9g1j | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 8qm7 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zou | | Status: | HPUB -- hold until publication | | Title: | Respirasome open state 2 in presence of metformin (SC-MetO2) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 9g1k | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 8qm8 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zp8 | | Status: | HPUB -- hold until publication | | Title: | Respirasome open state 1 in presence of metformin(SC-MetO1) | | Authors: | Teng, F., He, Z.X., Hu, Y.Q., Xu, C.Y., Guo, R.Y., Zhou, L. | | Deposition date: | 2024-05-29 |
|
| PDBID: | 9g1l | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 8qm9 | | Status: | HPUB -- hold until publication | | Title: | Potential drug binding sites for translation initiation factor eIF4E | | Authors: | Cleasby, A. | | Deposition date: | 2023-09-21 | | Release date: | 2025-03-21 |
|
| PDBID: | 8zor | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-29 |
|
| PDBID: | 9g1m | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
| PDBID: | 8qn2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-09-25 | | Release date: | 2025-03-25 |
|
| PDBID: | 9g1n | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-07-10 | | Sequence: | >Entity 1
MLSGLNHLTLAVSQLAPSVAFYQQLLGMTLHARWDSGAYLSCGDLWLCLSLDPQRRVTPPEESDYTHYAFSISEADFASFAARLEAAGVAVWKLNRSEGASHYFLDPDGHKLELHVGSLAQRLAACREQPYKGMVFFEQHHHHHH
|
|
