| PDBID: | 9fcs | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H122N mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIHNLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGS
|
|
| PDBID: | 8q4f | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8xp1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-02 |
|
| PDBID: | 9fcu | | Status: | HPUB -- hold until publication | | Title: | CysG(N-16)-H121A mutant in complex with SAH from Kitasatospora cystarginea | | Authors: | Kuttenlochner, W., Beller, P., Kaysser, L., Groll, M. | | Deposition date: | 2024-05-15 | | Sequence: | >Entity 1
GSTYDALRRQLIPSFDLLYGSAVSVVAMSVPATARILDLGAGTGLLGAALRERLPDAELLLQDRSQAMLEQARQRFADDDQVAIRVADHLDELPAGPFDAVVSALSIAHLEHQDKQDLFTRIRKILRPGGIFVNVEQVLAPTSELEKMYDRQHEAHVLASDTPAEEWAAGRERMKHDIPIDVETQIQWLRDAGFTTADCLAKDWRFATYAGWNGSC
|
|
| PDBID: | 8kc5 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T09 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 9fd4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8kc4 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -NA05 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8xph | | Status: | HPUB -- hold until publication | | Title: | Marine Planctomycetes laminarinase PtLam | | Authors: | Yang, J. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fd5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xp4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fd6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8kc8 | | Status: | HPUB -- hold until publication | | Title: | De novo design protein -T11 | | Authors: | Wang, S., Liu, Y. | | Deposition date: | 2023-08-06 |
|
| PDBID: | 8xp6 | | Status: | HPUB -- hold until publication | | Title: | 2OG-Fe(II) oxygenase-ColD | | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fd8 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-chloro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xp7 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fd9 | | Status: | HPUB -- hold until publication | | Title: | Re-engineered peroxygenase variant of 2-deoxy-D-ribose-5-phosphate aldolase, Schiff-base complex with 4-nitro-cinnamaldehyde | | Authors: | Thunnissen, A.M.W.H., Zhou, H., Frietema, H.O.T., Poelarends, G.J. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8xpf | | Status: | HPUB -- hold until publication | | Title: | 2OG-Fe(II) oxygenase-ColD in complex with collinodins | | Authors: | Zhang, B., Shi, J., Zhang, Y., Ge, H.M. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fcz | | Status: | HPUB -- hold until publication | | Title: | Coxsackievirus A9 bound with compound 17 (CL301) | | Authors: | Plavec, Z., Butcher, S.J., Mitchell, C., Buckner, C. | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8q51 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 9fd1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8q4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8xpk | | Status: | HPUB -- hold until publication | | Title: | Marine bacterial laminarinase PtLam mutant E154A in complex with laminatriose | | Authors: | Yang, J. | | Deposition date: | 2024-01-03 |
|
| PDBID: | 9fd0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-05-16 |
|
| PDBID: | 8q4s | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of phosphoserine phosphatase (SerB) from Brucella melitensis in complex with AP4 and magnesium. | | Authors: | Scaillet, T., Wouters, J. | | Deposition date: | 2023-08-07 |
|
| PDBID: | 8xpp | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-01-04 |
|
