| PDBID: | 9ew0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8vwo | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-02-01 |
|
| PDBID: | 9ew3 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12-mer (pS259) and compound 78 (1084378) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8w08 | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of the worst case reconstruction of the ancestral triosephosphate isomerase of the last opisthokont common ancestor obtained by maximum likelihood | | Authors: | Perez-Nino, J.A., Rodriguez-Romero, A., Guerra-Borrego, Y., Fernandez-Velasco, D.A. | | Deposition date: | 2024-02-13 |
|
| PDBID: | 9ew4 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide 12mer (pS259) and compound 86 (1124384) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x1b | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 9ew5 | | Status: | HPUB -- hold until publication | | Title: | Ternary structure of 14-3-3s, C-RAF phosphopeptide (pS259) 12mer and compound 23 (1083848) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x10 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 9ew7 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and CRAF phosphopeptide (pS259) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x11 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 9ew6 | | Status: | HPUB -- hold until publication | | Title: | Binary structure of 14-3-3s and BRAF phosphopeptide (pS365) | | Authors: | Konstantinidou, M., Vickery, H., Pennings, M.A.M., Virta, J., Visser, E.J., Oetelaar, M.C.M., Overmans, M., Neitz, J., Ottmann, C., Brunsveld, L., Arkin, M.R. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x13 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 9ewb | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 | | Sequence: | >Entity 1
GAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEACSIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSLEDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRRGKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVKGETKYLGVCRLPGPGRRHRRLDIRVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNTHGAKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
>Entity 2
(DC)(DG)(DG)(DC)(DA)(DG)(DT)(DA)(DC)(DT)(DG)
>Entity 3
(DC)(DA)(DG)(DT)(DA)(DC)
>Entity 4
(DG)(DC)(DC)(DG)
|
|
| PDBID: | 8x14 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 9ewd | | Status: | HPUB -- hold until publication | | Title: | DNA Polymerase Lambda I493K E529D, TTP:At Ca2+ Ground State Ternary Complex | | Authors: | Nourisson, A., Haouz, A., Missoury, S., Delarue, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x12 | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 8x0z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-06 |
|
| PDBID: | 8x1i | | Status: | HPUB -- hold until publication | | Title: | ParM present of genome of Desufitobacterium hafniense - Dh-cParM1 | | Authors: | Ali, S., Robinson, R.C., Narita, A. | | Deposition date: | 2023-11-07 |
|
| PDBID: | 9ew8 | | Status: | HPUB -- hold until publication | | Title: | Discovery of a Series of Covalent, Cell Active Bfl-1 Inhibitors | | Authors: | Hargreaves, D. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x1e | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-07 |
|
| PDBID: | 8x1j | | Status: | HPUB -- hold until publication | | Title: | Study on the Mechanism of Dye Decolorizing Peroxidase Degradation of PVC | | Authors: | Zhang, Z., Yanng, D. | | Deposition date: | 2023-11-08 | | Sequence: | >Entity 1
MSQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRWVEERDLSGFVDGTENPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLNRMSVPDQEMMIGRTKEANEEIDGDERPVTSHLSRVDLKEDGKGLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFGDTDGKRDAMLRFTKPVTGGYYFAPSLERIQAL
>Entity 2
SQVQSGILPEHCRAAIWIEANVKGDVNALREASKNFVDNVATFQAKFPDAKLGAVVAFGNNVWRQLSGGEGAEELKDFPVYGKGLAPSTQYDLLIHILSARHEVNFSVAQAAMAAFGDAIDVKEEIHGFRPAGEETRREVAVIKDGVDAGGSYVFVQRWEHNLKQLKIVRQSLPYGTASGTHGLYFCAYCARLYNIEQQLLSMFMLRFTKPVTGGYYFAPSLERIQAL
|
|
| PDBID: | 9ewa | | Status: | HPUB -- hold until publication | | Title: | The sTeLIC pentameric Ligand-Gated Ion Channel (wild-type) in complex with 4-Bromophenethylamine | | Authors: | Fourati, Z., Delarue, M. | | Deposition date: | 2024-04-03 |
|
| PDBID: | 8x1o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-08 |
|
| PDBID: | 8ixn | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-04-01 | | Release date: | 2024-10-01 |
|
| PDBID: | 9ew2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-04-03 |
|
