| PDBID: | 9udn | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udp | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udr | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9uds | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udt | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udl | | Status: | HPUB -- hold until publication | | Title: | Cocrystal structure of human cytosolic phenylalanyl-tRNA synthetase and an inhibitor | | Authors: | Qiao, H., Hei, Z., Fang, P. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udq | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA42 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9ue0 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of MPXV A35R in complex with a neutralizing antibody MA49 | | Authors: | Sun, D., Zhang, N., Guo, Y. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udu | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udm | | Status: | HPUB -- hold until publication | | Title: | Cocrystal structure of human cytosolic phenylalanyl-tRNA synthetase and an inhibitor in the presence of ATP | | Authors: | Qiao, H., Hei, Z., Fang, P. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9udj | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of PSD95 in complex with 4-dimethylaminophenol | | Authors: | Li, H., Ouyang, Q., Zhu, J. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3d | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of broadly neutralizing antibody HEPC108 in complex with Hepatitis C virus envelope glycoprotein E2 ectodomain | | Authors: | Flyak, A.I., Wilcox, X.E. | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3v | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3w | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3u | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGAIGTVMTFL
|
|
| PDBID: | 9o3t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISAIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3s | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADAVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
| PDBID: | 9o3e | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o39 | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the E. coli HtpG N-terminal and middle domain dimer in complex with AMPPNP | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3f | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-04-07 |
|
| PDBID: | 9o3c | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a fully closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3a | | Status: | REPL -- author sent new coordinates, entry to be reprocessed | | Title: | Cryo-EM structure of the cyanobacterial HtpG N-terminal and middle domain dimer in complex with AMPPNP in a semi-closed state | | Authors: | Jiang, L., Ye, Q., Boyenle, I.D., Liu, Y. | | Deposition date: | 2025-04-07 | | Release date: | 2026-04-07 |
|
| PDBID: | 9o3r | | Status: | HPUB -- hold until publication | | Title: | Crystal Structure of I64A Variant of D-Dopachrome Tautomerase (D-DT) | | Authors: | Pilien, A.V.R., Argueta, C., Parkins, A., Pantouris, G. | | Deposition date: | 2025-04-07 | | Sequence: | >Entity 1
PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSAGVVGTAEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL
|
|
