| PDBID: | 9ny5 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | LmuABC_apo | | Authors: | Chakravarti, A., Zhang, Z. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9ny6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoy | | Status: | HPUB -- hold until publication | | Title: | Pseudomonas aeruginosa APH(3"")-IIb - Wild Type | | Authors: | Kowalewski, J., Tomaszczyk, M., Guichou, J.F., Gelin, M., Labesse, G., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoq | | Status: | HPUB -- hold until publication | | Title: | Leishmania donovani ISP2 in complex with bovine trypsin | | Authors: | Freitag-Pohl, S., Pohl, E. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoj | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qov | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of [2Fe-2S]b D4A-FNR of A. fischeri | | Authors: | Volbeda, A., Fontecilla-Camps, J.C., Rohac, R. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoo | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qon | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qop | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp8 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Diels Alderase Cyc15b | | Authors: | Yang, S., Kisa, D., Basle, A., Race, P.R. | | Deposition date: | 2025-03-26 | | Release date: | 2026-03-26 |
|
| PDBID: | 9qpc | | Status: | HPUB -- hold until publication | | Title: | DNA polymerase with inhibitor | | Authors: | Lamers, M.H., Urem, M., Smits, W.K. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoe | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-Id with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qog | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Affitin C10 in complex with a a double-helical aromatic oligoamide foldamer | | Authors: | Sigl, J.C., Sachs, J., Merlet, E., Ferrand, Y., Huc, I. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp9 | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qp4 | | Status: | HPUB -- hold until publication | | Title: | Pre-active dark-state structure of human short-wave-sensitive opsin (OPN1SW) | | Authors: | Schmidt, S.L., Isaikina, P. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qoc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qod | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMRTYTFDQVEKAIEQLYPDFTINTIEISGEGNDCIAYEINRDFIFKFPKHSRGSTNLFNEVNILKRIHNKLPLPIPEVVFTGMPSETYQMSFAGFTKIKGVPLTPLLLNNLPKQSQNQAAKDLARFLSELHSINISGFKSNLVLDFREKINEDNKKIKKLLSRELKGPQMKKVDDFYRDILENEIYFKYYPCLIHNDFSSDHILFDTEKNTICGIIDFGDAAISDPDNDFISLMEDDEEYGMEFVSKILNHYKHKDIPTVLEKYRMKEKYWSFEKIIYGKEYGYMDWYEEGLNEIRSIKIK
|
|
| PDBID: | 9qoi | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalemski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qpb | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qok | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qol | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with a fragment | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qor | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qos | | Status: | HPUB -- hold until publication | | Title: | APH(3'')-IIb with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qot | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
| PDBID: | 9qou | | Status: | HPUB -- hold until publication | | Title: | APH(2'''')-IVa with an inhibitor | | Authors: | Guichou, J.F., Gelin, M., Tomaszczyk, M., Kowalewski, J., Lionne, C. | | Deposition date: | 2025-03-26 |
|
