PDBID: | 8xgz | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-16 |
|
PDBID: | 8rhd | Status: | HPUB -- hold until publication | Title: | Crystal structure of Neisseria gonorrhoeae FabI in complex with NADH and (E)-3-((2R,3S)-3-hydroxy-2-methyl-4-oxo-2,3,4,5-tetrahydro-1H-pyrido[2,3-b][1,4]diazepin-8-yl)-N-methyl-N-((3-methylbenzofuran-2-yl)methyl)acrylamide | Authors: | Ronin, C., Gerusz, V., Ciesielski, F. | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhb | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rha | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhh | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Deposition date: | 2023-12-15 |
|
PDBID: | 8rho | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8rhm | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 | Sequence: | >Entity 1 GPGSRTPVELRLTEIFRDVLGHDAFGVLDDFFELGGDSFKAIRIAAKYGPPLEVTDIYDHPTIEALAAHLAR
|
|
PDBID: | 8vdl | Status: | HPUB -- hold until publication | Title: | HB3VAR03 CIDRa1.4 domain with C7 Fab | Authors: | Hurlburt, N.K., Pancera, M. | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdf | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human monoclonal antibody C7 targeting IT4VAR22 CIDRa1.7 (PfEMP1 A) | Authors: | Raghavan, S.S.R., Ward, A.B. | Deposition date: | 2023-12-15 |
|
PDBID: | 8vdg | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of human monoclonal antibody C74 targeting IT4VAR22 CIDRa1.7 | Authors: | Raghavan, S.S.R., Ward, A.B. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg4 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg5 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg6 | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg9 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM3 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg7 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM1 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xg8 | Status: | HPUB -- hold until publication | Title: | Crystal structure of phenylacetone monooxygenase mutant PM2 bound to FAD and NADP | Authors: | Li, X., Sun, Z.T. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgx | Status: | HPUB -- hold until publication | Title: | beta-1,4-galacosyltransferase | Authors: | Luo, G., Huang, Z., Chen, J., Hou, X., Zhu, Y., Ni, D., Xu, W., Zhang, W., Rao, Y., Mu, W. | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgj | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgf | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgd | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xge | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgh | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgi | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|
PDBID: | 8xgp | Status: | HPUB -- hold until publication | Deposition date: | 2023-12-15 |
|