PDBID: | 8v1w | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1v | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v22 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1q | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1y | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1r | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1s | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1t | Status: | AUTH -- processed, waiting for author review and approval | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1z | Status: | AUTH -- processed, waiting for author review and approval | Title: | Structure of monoclonal antibody 1A05 in complex with BA.1 RBD | Authors: | Bajic, G., Alesandro, C. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1u | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-21 |
|
PDBID: | 8v23 | Status: | HPUB -- hold until publication | Title: | Crystal structure of HIV-1 capsid N-terminal domain in the presence of Lenacapavir | Authors: | Briganti, L., Kvaratskhelia, M. | Deposition date: | 2023-11-21 |
|
PDBID: | 8v1x | Status: | HPUB -- hold until publication | Title: | Crystal structure of polyketide synthase (PKS) thioreductase domain from Streptomyces coelicolor | Authors: | Pereira, J.H., Dan, Q., Keasling, J., Adams, P.D. | Deposition date: | 2023-11-21 |
|
PDBID: | 8x67 | Status: | HPUB -- hold until publication | Title: | solution structure of Pru p 7 | Authors: | Zheng, J., Aizawa, T., Kumeta, H. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 GSSFCDSKCGVRCSKAGYQERCLKYCGICCEKCHCVPSGTYGNKDECPCYRDLKNSKGNPKCP
|
|
PDBID: | 8x60 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8x68 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH21002 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x65 | Status: | HPUB -- hold until publication | Title: | Crystal structure of X11P(P71T) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGNHGGYFYSFWTDGGGSVSFCLQNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x66 | Status: | HPUB -- hold until publication | Title: | Crystal structure of triple mutant X11P(P71T+N13F+Q34L) xylanase from a metagenome derived gene from sugarcane bagasse collection site | Authors: | Chitnumsub, P., Jaruwat, A., Boonyapakron, K., Prabmark, K. | Deposition date: | 2023-11-20 | Sequence: | >Entity 1 MAQQCITSSQTGFHGGYFYSFWTDGGGSVSFCLLNGGRYTSQWSNVGNWVGGKGWQTGGRRVVSYSGTFNTSGNSYLALYGWTTNPLVEYYIVDSWGTWRPPGGEGYMGTVFSDGGWYDVYRTQRVNAPSIEGIRTFYQYWSVRQQKRVGGTITTGNHFDAWASYGMNLGTHNYMVMATEGFQSSGSSDITVSDGGSSSLEHHHHHH
|
|
PDBID: | 8x62 | Status: | HPUB -- hold until publication | Title: | crystal structure of human Mcl-1 kinase domain in complex with RM1 | Authors: | Zhang, Z.M., Wang, L. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x69 | Status: | HPUB -- hold until publication | Title: | Complex structure of AtHPPD with YH23010 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8x6a | Status: | AUTH -- processed, waiting for author review and approval | Title: | Complex structure of AtHPPD with Y18992 | Authors: | Yang, G.-F., Lin, H.-Y., Dong, J. | Deposition date: | 2023-11-20 |
|
PDBID: | 8r64 | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8v1m | Status: | HPUB -- hold until publication | Deposition date: | 2023-11-20 |
|
PDBID: | 8v1n | Status: | HPUB -- hold until publication | Title: | Cryo-EM structure of tau filaments made from jR2R3-P301L peptides induced with heparin | Authors: | Vigers, M., Han, S. | Deposition date: | 2023-11-20 |
|
PDBID: | 8v18 | Status: | HPUB -- hold until publication | Title: | RNA polymerase II elongation complex with 8-oxoguanine with bound AMPCPP | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-20 |
|
PDBID: | 8v19 | Status: | REPL -- author sent new coordinates, entry to be reprocessed | Title: | RNA polymerase II elongation complex with Syn conformation 8-oxoguanine with AMP added | Authors: | Oh, J., Wang, D. | Deposition date: | 2023-11-20 |
|