| PDBID: | 8x4d | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (TM helix S0,20 uM Ca2+, 2 mM ATP) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4u | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8x4e | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (TM helix S0, 5 mM Ca2+) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4b | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (TM helix S0,100 nM Ca2+, open state) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4t | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4y | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4c | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, 2 mM ATP) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4v | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-11-15 | | Release date: | 2025-05-15 |
|
| PDBID: | 8x4r | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4s | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8x4q | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-15 |
|
| PDBID: | 8r4n | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of neutralizing Fab Eq4.Dp46-3A from equine antivenom bound to short chain three finger alpha-neurotoxin from Dendroaspis polylepis. | | Authors: | Wibmer, C.K. | | Deposition date: | 2023-11-14 | | Release date: | 2025-05-14 |
|
| PDBID: | 8r4p | | Status: | HPUB -- hold until publication | | Title: | Structure of BabA from Helicobacter pylori strain 17875 | | Authors: | Persson, K., Boren, T., Bugaytsova, J. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4l | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant without Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4m | | Status: | HPUB -- hold until publication | | Title: | CSP1 M48L mutant with Iodide | | Authors: | Basle, A., David, S., Dennison, C. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8r4y | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 | | Release date: | 2025-05-14 |
|
| PDBID: | 8uyv | | Status: | HPUB -- hold until publication | | Title: | HBV T=4 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyw | | Status: | HPUB -- hold until publication | | Title: | HBV T=3 3A mutant capsid from HEK-293T cells | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRAPRRRTPAPRRRRSQAPRRRRSQSREPQC
|
|
| PDBID: | 8uyx | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Wild-type control) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTL
|
|
| PDBID: | 8uyy | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (Preassembled capsid incubated with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uyz | | Status: | HPUB -- hold until publication | | Title: | HBV Cp149 capsid protein (HBV dimer co-assembled with triton X-100) | | Authors: | Bianchini, E.N., Wang, J.C.Y., Hu, J. | | Deposition date: | 2023-11-14 | | Sequence: | >Entity 1
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
|
|
| PDBID: | 8uzc | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Structure of UT14 Fab in complex with the head domain of H3 (A/Singapore/INFIMH-16-0019/2016) | | Authors: | Park, J., Georgiou, G. | | Deposition date: | 2023-11-14 |
|
| PDBID: | 8x3x | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3y | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-11-14 | | Release date: | 2024-11-14 |
|
| PDBID: | 8x3z | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-11-14 |
|
