| PDBID: | 9n7w | | Status: | HPUB -- hold until publication | | Title: | antibody 5E10 Fab | | Authors: | Rupert, P.B., Strong, R.K. | | Deposition date: | 2025-02-06 | | Sequence: | >Entity 1
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLNWYQQKPDGTFKLLIYYTSRLHSGVPSRFSGGGSGTDYSLTISNLEKEDIATYFCQQGNTLPRTFGGGTRLEVKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
>Entity 2
(PCA)VQLLQPGAELVRPGASVRLSCKTSGYTFTSYWINWVKQRPGQGLEWIGKIFPSDSHTNYNQKFKDKATLTVDKSSSTAYMQLISPTSEDSAVYYCTRDFDTQFYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
|
| PDBID: | 9n7x | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-06 |
|
| PDBID: | 9lt0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsz | | Status: | HPUB -- hold until publication | | Title: | Inward-open Structure of human B0AT1 | | Authors: | Imazu, T., Miyaguchi, I., Hiraizumi, M. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsx | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt3 | | Status: | HPUB -- hold until publication | | Title: | Integrin alpha-v beta-3 in complex with Trimucrin | | Authors: | Wang, Y.T., Chuang, W.J. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsw | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt1 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt2 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt4 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt5 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt6 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt8 | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9ltb | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9lt9 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Gle1 from Debaryomyces hansenii | | Authors: | Jang, M.J., Chang, J.H. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8r | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | CP of RHDV VLP (VP1) | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8j | | Status: | WAIT -- processing started, waiting for author input to continue processing | | Title: | AB Spike of RHDV mutant N15 | | Authors: | Novoa, G., Martinez-Romero, J.M., Perez-Mata, C., Barcena, J., Caston, J.R. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8p | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8u | | Status: | HPUB -- hold until publication | | Title: | Upregulated state of BetP with Potassium in Amphipol A8-35 | | Authors: | Urbansky, K., Fu, L., Madej, M.G., Ziegler, C. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8l | | Status: | HPUB -- hold until publication | | Title: | X-ray structure of a polyoxidovanadate/lysozyme adduct obtained when the protein is treated with [VIVO(acac)2] at 310 K | | Authors: | Tito, G., Ferraro, G., Merlino, A. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8q | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8s | | Status: | HPUB -- hold until publication | | Title: | PhiC31 dimer on attP site | | Authors: | Spagnolo, L., Sun, Y.E., Joseph, A.P. | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8t | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
| PDBID: | 9i8k | | Status: | HPUB -- hold until publication | | Deposition date: | 2025-02-05 |
|
