| PDBID: | 9gzf | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-03 |
|
| PDBID: | 9gyv | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-03 |
|
| PDBID: | 9gyw | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-03 |
|
| PDBID: | 9gyx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-03 |
|
| PDBID: | 9gyf | | Status: | HPUB -- hold until publication | | Title: | Ku70/80 with PAXX peptide mutation K193R | | Authors: | Chaplin, A.K., Malewicz, M. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9jt4 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aldo-keto reductase 1C3 complexed with compound S30-1023 | | Authors: | Jiang, J., Sun, H., Fang, P. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9jt5 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aldo-keto reductase 1C3 complexed with compound S30-1023x | | Authors: | Jiang, J., Sun, H., Fang, P. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9jt6 | | Status: | HPUB -- hold until publication | | Title: | Crystal structure of Aldo-keto reductase 1C3 complexed with compound S30-1045 | | Authors: | Jiang, J., Sun, H., Fang, P. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9dtx | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9dty | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9du0 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9duh | | Status: | HPUB -- hold until publication | | Title: | E. Coli Glucokinase - K214Q | | Authors: | Andrews, J.R.W., Fan, C., Sakon, J. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9duc | | Status: | HPUB -- hold until publication | | Title: | Wild-Type E. coli Glucokinase | | Authors: | Andrews, J.R.W., Fan, C., Sakon, J. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9dtw | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of the ternary complex of human FKBP12, QDPR and Compound 4 | | Authors: | Romanowski, M.J., Viscomi, J.S. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9du1 | | Status: | HPUB -- hold until publication | | Title: | Co-crystal structure of the ternary complex of human FKBP12, BRD9 bromo domain and Compound 1 | | Authors: | Romanowski, M.J., Viscomi, J.S. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9gyt | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-02 | | Release date: | 2025-10-02 |
|
| PDBID: | 9gyg | | Status: | HPUB -- hold until publication | | Title: | The structure of ornithine decarboxylase from Leishmania infantum in complex with PLP | | Authors: | Fiorillo, A., Antonelli, A., Ilari, A., Tria, G. | | Deposition date: | 2024-10-02 | | Sequence: | >Entity 1
MGSSHHHHHHSSGLVPRGSHMGDHDVALCHVSRYNHANYWAFVPLPTVSDDTGCDSLHHDSASERIRMAPPASASKAGAAEERLHPYERRLLDQYQIHLQPANRNPLSRADSAAGREETAQTPAQVQMVSGVAVADSTSDQHASVASSQDLVDLFFLEGSQAVDGLCFSPYPIYGWRTAEERRAAVCEVFKTYNVVTRLPASPAALAAAQRRYSRHRHSAIAPINKSAIETREQYWRRLSNLYTQKGVKDAASAADAAATTATNGAVPAAPAYEPEDPFYIIDLGRVVEQMARWRHELPMVRPYFAV(LLP)SNPQPAVLEVLSALGAGFDCASKEEIHMVLGRQLVASPDDIIFANPCKQLGDLREAQACGVTYVTVDNPLEMEKISRLMPSAHAIIRIKTNDSKAQCSFSTKFGAPLEDVEGLLEAARQFNVTVCGVSFHVGSGNDDQSAYVSAVRDAYQVFQQAVQYGFKCTILDIGGGFPGTEVVEGSGNTSFEAIARTIRPVLAELFGGGDVTIISEPGRYFTAASHALLMNVFASRTLRLSDVEVSRQAFQSVVSMDEPEEYQYYVNDGLYHSFNCILFDHAHPTLLLLNDGDGADGVESGTEAAAVCSEEEGETSLSGPLANDALFMSAWDRRRSFARRPLRITTIFGPTCDSMDCILKKQPFPEMKLGDWLLVPDMGSYTTAAAGFFNGFATRRLEWVSSVDLCARPRPVYTREGNTLRCVSE
|
|
| PDBID: | 9gy9 | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9gyi | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9gym | | Status: | HPUB -- hold until publication | | Title: | Estructure of Arbitrium receptor | | Authors: | Gallego del Sol, F., Marina, A. | | Deposition date: | 2024-10-02 |
|
| PDBID: | 9jss | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9jt0 | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | Chito oligosaccharide deacetylase from vibrio campbellii (VhCOD) complex with Chitobiose | | Authors: | Sirikan, P., Tamo, F., Robinson, R.C., Wipa, S. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9jsr | | Status: | HPUB -- hold until publication | | Title: | 50S precursor - Erm complex (C-I) | | Authors: | Sengupta, S., Mukherjee, R., Pilsl, M., Bagale, S., Adhikary, A.D., Borkar, A., Pradeepkumar, P.I., Engel, C., Chowdhury, A., Kaushal, P.S., Anand, R. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9jsq | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The mutant structure of Dihydroxyacid dehydratase (DHAD)-I177F | | Authors: | Zhou, J., Zang, X., Tang, Y., Yan, Y. | | Deposition date: | 2024-10-01 |
|
| PDBID: | 9jsy | | Status: | HPUB -- hold until publication | | Deposition date: | 2024-10-01 |
|
