| PDBID: | 8wz6 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021 in ternary complex with NAD and DZNep | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz7 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(I255A,T287A) in ternary complex with NAD and adenosine | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wz8 | | Status: | HPUB -- hold until publication | | Title: | The crystal structure of Legionella pneumophila adenosylhomocysteinase Lpg2021(T67A,Q69A) complex with NAD | | Authors: | Gao, Y.S., Xie, R., Chen, Y.N., Ma, J.M., Ge, H.H. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8wza | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of human pannexin 3 in nanodisc | | Authors: | Hang, Z., Huawei, Z., Daping, W. | | Deposition date: | 2023-11-01 |
|
| PDBID: | 8r0n | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0o | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0k | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0m | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0p | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8r0t | | Status: | HOLD -- hold until a certain date | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8r0h | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with (E)-3-(2-(thiophen-2-yl)vinyl)-3,4-dihydroquinoxalin-2(1H)-one and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0q | | Status: | HPUB -- hold until publication | | Title: | Pim1 in complex with 6-bromo-1H-benzo[d]imidazol-2-amine and Pimtide | | Authors: | Hochban, P.M.M., Heine, A., Diederich, W.E. | | Deposition date: | 2023-10-31 | | Sequence: | >Entity 1
SMLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFWQVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSPPEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIGGQVFFRQRVS(SEP)ECQHLIRWCLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPS
>Entity 2
ARKRRRHPSGPPTA
|
|
| PDBID: | 8r0l | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uti | | Status: | HPUB -- hold until publication | | Title: | Eukaryotic 80S ribosome with Reh1 and A/P site tRNA | | Authors: | Yelland, J.N., Taylor, D.W., Johnson, A.W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8uth | | Status: | HPUB -- hold until publication | | Title: | Active site binding triggers E1-rearrangements revealing E1-E2 lipoyl domain interactions in the Pyruvate dehydrogenase complex | | Authors: | Arjunan, P., Whitley, M., Furey, W. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8utj | | Status: | HPUB -- hold until publication | | Deposition date: | 2023-10-31 | | Release date: | 2025-05-16 |
|
| PDBID: | 8wyq | | Status: | AUTH -- processed, waiting for author review and approval | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyk | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (2 mM EGTA, closed state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyl | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wym | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (100 nM Ca2+, pre-open state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyn | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (5 mM Ca2+, closed state) | | Authors: | Qiang, C., Hongli, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyh | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The global map of Omicron Subvariants Spike with ACE2 | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8wyj | | Status: | AUTH -- processed, waiting for author review and approval | | Title: | The global map of Omicron Subvariants Spike with two antibodies | | Authors: | Yan, R.H., Wang, A.J., Yang, H.N. | | Deposition date: | 2023-10-31 | | Release date: | 2024-10-31 |
|
| PDBID: | 8wyo | | Status: | HPUB -- hold until publication | | Title: | Cryo-EM structure of Ryanodine receptor 1 (20 uM Ca2+, open state) | | Authors: | Chen, Q., Hu, H. | | Deposition date: | 2023-10-31 |
|
| PDBID: | 8wyw | | Status: | HOLD -- hold until a certain date | | Title: | Crystal structure of spleen tyrosine kinase (SYK) in complex with SKI-O-592 (free form of SKI-O-703, cevidoplenib) | | Authors: | Bong, S.M., Lee, B.I. | | Deposition date: | 2023-10-31 | | Release date: | 2024-11-06 |
|
